PDB entry 6gey

View 6gey on RCSB PDB site
Description: Trypanosoma brucei PTR1 in complex with inhibitor 4g (F125)
Class: oxidoreductase
Keywords: Trypanosoma brucei, pteridine reductase, PTR1, TbPTR1, benzothiazole, OXIDOREDUCTASE
Deposited on 2018-04-27, released 2019-04-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-03, with a file datestamp of 2019-03-29.
Experiment type: XRAY
Resolution: 1.56 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pteridine reductase
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Gene: PTR1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6geya_
  • Chain 'B':
    Compound: pteridine reductase
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Gene: PTR1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6geyb_
  • Chain 'C':
    Compound: pteridine reductase
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Gene: PTR1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6geyc_
  • Chain 'D':
    Compound: pteridine reductase
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Gene: PTR1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6geyd_
  • Heterogens: NAP, EWT, DMS, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6geyA (A:)
    mgsshhhhhhssglvprgshmeapaavvtgaakrigraiavklhqtgyrvvihyhnsaea
    avsladelnkersntavvcqadltnsnvlpasceeiinscfrafgrcdvlvnnasafypt
    plvqgdhednsngktvetqvaeligtnaiapflltmsfaqrqkgtnpnctssnlsivnlc
    damvdqpcmafslynmgkhalvgltqsaalelapygirvngvapgvsllpvamgeeekdk
    wrrkvplgrreasaeqiadaviflvsgsaqyitgsiikvdgglslvha
    

    Sequence, based on observed residues (ATOM records): (download)
    >6geyA (A:)
    meapaavvtgaakrigraiavklhqtgyrvvihyhnsaeaavsladelnkersntavvcq
    adltnsnvlpasceeiinscfrafgrcdvlvnnasafyptplvqgktvetqvaeligtna
    iapflltmsfaqrqksnlsivnlcdamvdqpcmafslynmgkhalvgltqsaalelapyg
    irvngvapgvsllpvamgeeekdkwrrkvplgrreasaeqiadaviflvsgsaqyitgsi
    ikvdgglslvha
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6geyB (B:)
    mgsshhhhhhssglvprgshmeapaavvtgaakrigraiavklhqtgyrvvihyhnsaea
    avsladelnkersntavvcqadltnsnvlpasceeiinscfrafgrcdvlvnnasafypt
    plvqgdhednsngktvetqvaeligtnaiapflltmsfaqrqkgtnpnctssnlsivnlc
    damvdqpcmafslynmgkhalvgltqsaalelapygirvngvapgvsllpvamgeeekdk
    wrrkvplgrreasaeqiadaviflvsgsaqyitgsiikvdgglslvha
    

    Sequence, based on observed residues (ATOM records): (download)
    >6geyB (B:)
    meapaavvtgaakrigraiavklhqtgyrvvihyhnsaeaavsladelnkersntavvcq
    adltnsnvlpasceeiinscfrafgrcdvlvnnasafyptplvqgktvetqvaeligtna
    iapflltmsfaqrqssnlsivnlcdamvdqpcmafslynmgkhalvgltqsaalelapyg
    irvngvapgvsllpvamgeeekdkwrrkvplgrreasaeqiadaviflvsgsaqyitgsi
    ikvdgglslvha
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6geyC (C:)
    mgsshhhhhhssglvprgshmeapaavvtgaakrigraiavklhqtgyrvvihyhnsaea
    avsladelnkersntavvcqadltnsnvlpasceeiinscfrafgrcdvlvnnasafypt
    plvqgdhednsngktvetqvaeligtnaiapflltmsfaqrqkgtnpnctssnlsivnlc
    damvdqpcmafslynmgkhalvgltqsaalelapygirvngvapgvsllpvamgeeekdk
    wrrkvplgrreasaeqiadaviflvsgsaqyitgsiikvdgglslvha
    

    Sequence, based on observed residues (ATOM records): (download)
    >6geyC (C:)
    eapaavvtgaakrigraiavklhqtgyrvvihyhnsaeaavsladelnkersntavvcqa
    dltnsnvlpasceeiinscfrafgrcdvlvnnasafyptplvqgktvetqvaeligtnai
    apflltmsfaqrqssnlsivnlcdamvdqpcmafslynmgkhalvgltqsaalelapygi
    rvngvapgvsllpvamgeeekdkwrrkvplgrreasaeqiadaviflvsgsaqyitgsii
    kvdgglslvha
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6geyD (D:)
    mgsshhhhhhssglvprgshmeapaavvtgaakrigraiavklhqtgyrvvihyhnsaea
    avsladelnkersntavvcqadltnsnvlpasceeiinscfrafgrcdvlvnnasafypt
    plvqgdhednsngktvetqvaeligtnaiapflltmsfaqrqkgtnpnctssnlsivnlc
    damvdqpcmafslynmgkhalvgltqsaalelapygirvngvapgvsllpvamgeeekdk
    wrrkvplgrreasaeqiadaviflvsgsaqyitgsiikvdgglslvha
    

    Sequence, based on observed residues (ATOM records): (download)
    >6geyD (D:)
    eapaavvtgaakrigraiavklhqtgyrvvihyhnsaeaavsladelnkersntavvcqa
    dltnsnvlpasceeiinscfrafgrcdvlvnnasafyptplvqgktvetqvaeligtnai
    apflltmsfaqrqsnlsivnlcdamvdqpcmafslynmgkhalvgltqsaalelapygir
    vngvapgvsllpvamgeeekdkwrrkvplgrreasaeqiadaviflvsgsaqyitgsiik
    vdgglslvha