PDB entry 6ges

View 6ges on RCSB PDB site
Description: Crystal structure of ERK1 covalently bound to SM1-71
Class: transferase
Keywords: kinase, covalent inhibitor, MAPK, Structural Genomics, Structural Genomics Consortium, SGC, TRANSFERASE
Deposited on 2018-04-27, released 2019-02-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-27, with a file datestamp of 2019-02-22.
Experiment type: XRAY
Resolution: 2.07 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 3
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK3, ERK1, PRKM3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gesa_
  • Chain 'B':
    Compound: Mitogen-activated protein kinase 3
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK3, ERK1, PRKM3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gesb_
  • Heterogens: 6H3, EWH, SO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gesA (A:)
    smaaaaaqgggggeprrtegvgpgvpgevemvkgqpfdvgprytqlqyigegaygmvssa
    ydhvrktrvaikkispfehqtycqrtlreiqillrfrhenvigirdilrastleamrdvy
    ivqdlmetdlykllksqqlsndhicyflyqilrglkyihsanvlhrdlkpsnllinttcd
    lkicdfglariadpehdhtgflteyvatrwyrapeimlnskgytksidiwsvgcilaeml
    snrpifpgkhyldqlnhilgilgspsqedlnciinmkarnylqslpsktkvawaklfpks
    dskaldlldrmltfnpnkritveealahpyleqyydptdepvaeepftfamelddlpker
    lkelifqetarfqpgvleap
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gesA (A:)
    pgevemvkgqpfdvgprytqlqyigegaygmvssaydhvrktrvaikkispfehqtycqr
    tlreiqillrfrhenvigirdilrastleamrdvyivqdlmetdlykllksqqlsndhic
    yflyqilrglkyihsanvlhrdlkpsnllinttcdlkicdfglariadpehdhtgfltey
    vatrwyrapeimlnskgytksidiwsvgcilaemlsnrpifpgkhyldqlnhilgilgsp
    sqedlnciinmkarnylqslpsktkvawaklfpksdskaldlldrmltfnpnkritveea
    lahpyleqyydptdepvaeepftfamelddlpkerlkelifqetarfqpg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6gesB (B:)
    smaaaaaqgggggeprrtegvgpgvpgevemvkgqpfdvgprytqlqyigegaygmvssa
    ydhvrktrvaikkispfehqtycqrtlreiqillrfrhenvigirdilrastleamrdvy
    ivqdlmetdlykllksqqlsndhicyflyqilrglkyihsanvlhrdlkpsnllinttcd
    lkicdfglariadpehdhtgflteyvatrwyrapeimlnskgytksidiwsvgcilaeml
    snrpifpgkhyldqlnhilgilgspsqedlnciinmkarnylqslpsktkvawaklfpks
    dskaldlldrmltfnpnkritveealahpyleqyydptdepvaeepftfamelddlpker
    lkelifqetarfqpgvleap
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gesB (B:)
    pgevemvkgqpfdvgprytqlqyigegaygmvssaydhvrktrvaikkispfehqtycqr
    tlreiqillrfrhenvigirdilrastleamrdvyivqdlmetdlykllksqqlsndhic
    yflyqilrglkyihsanvlhrdlkpsnllinttcdlkicdfglariadpehdhtgfltey
    vatrwyrapeimlnskgytksidiwsvgcilaemlsnrpifpgkhyldqlnhilgilgsp
    sqedlnciinmkarnylqslpsktkvawaklfpksdskaldlldrmltfnpnkritveea
    lahpyleqyydptdepvaeepftfamelddlpkerlkelifqetarfqpg