PDB entry 6geq

View 6geq on RCSB PDB site
Description: Crystal structure of Mycobacterium tuberculosis cytochrome P450 CYP121A1 in complex with Triazole Pyrazole inhibitor 14a
Class: oxidoreductase
Keywords: Inhibitor complex P450, ANTIBIOTIC, oxidoreductase
Deposited on 2018-04-27, released 2019-08-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-08-07, with a file datestamp of 2019-08-02.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mycocyclosin synthase
    Species: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) [TaxId:83331]
    Gene: cyp121, MT2336
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6geqa_
  • Heterogens: EW5, HEM, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6geqA (A:)
    mtatvllevpfsargdripdavaelrtrepirkvrtitgaeawlvssyalctqvledrrf
    smketaaagaprlnaltvppevvnnmgniadaglrkavmkaitpkapgleqflrdtansl
    ldnlitegapadlrndfadplatalhckvlgipqedgpklfrslsiafmssadpipaaki
    nwdrdieymagilenpnittglmgelsrlrkdpayshvsdelfatigvtffgagvistgs
    flttalisliqrpqlrnllhekpelipagveellrinlsfadglprlatadiqvgdvlvr
    kgelvlvlleganfdpehfpnpgsieldrpnptshlafgrgqhfcpgsalgrrhaqigie
    allkkmpgvdlavpidqlvwrtrfqrriperlpvlw
    

    Sequence, based on observed residues (ATOM records): (download)
    >6geqA (A:)
    tatvllevpfsargdripdavaelrtrepirkvrtitgaeawlvssyalctqvledrrfs
    mketaaagaprlnaltvppevvnnmgniadaglrkavmkaitpkapgleqflrdtansll
    dnlitegapadlrndfadplatalhckvlgipqedgpklfrslsiafmssadpipaakin
    wdrdieymagilenpnittglmgelsrlrkdpayshvsdelfatigvtffgagvistgsf
    lttalisliqrpqlrnllhekpelipagveellrinlsfadglprlatadiqvgdvlvrk
    gelvlvlleganfdpehfpnpgsieldrpnptshlafgrgqhfcpgsalgrrhaqigiea
    llkkmpgvdlavpidqlvwrtrfqrriperlpvlw