PDB entry 6geh

View 6geh on RCSB PDB site
Description: structure and reactivity of a siderophore-interacting protein from the marine bacterium shewanella reveals unanticipated functional versatility.
Deposited on 2018-04-26, released 2018-11-21
The last revision was dated 2019-01-16, with a file datestamp of 2019-01-11.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: N/A
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FAD-binding 9, siderophore-interacting domain protein
    Species: Shewanella frigidimarina (strain NCIMB 400) [TaxId:318167]
    Gene: Sfri_2392
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MG, DMS, FMT, NA, GOL, FAD, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6gehA (A:)
sptrltyisdiieispylrrlvlsgeqlanfpadqqgayvkvlipqpgettvnmtltgpn
aaikrsytirefdpvrgqlsldfvinkhtgpatdwaklanvgdtvaiagpgplkmnrfdf
ndyllfgdstsinavdalikrlpatakghiimlvnshqeqallsqhpllkthwlvlndsi
taeqqidwlldklelfgdlpavtqvfvgleatqvrvikqylleqqqlplssisatgywkr
ntdadtfgkqkqmqpl