PDB entry 6ge8

View 6ge8 on RCSB PDB site
Description: Crystal structure of Mycobacterium tuberculosis BioA
Class: biosynthetic protein
Keywords: BioA, PLP, Hydrazine, Biotin, mycobacterium tuberculosis, transaminase, BIOSYNTHETIC PROTEIN
Deposited on 2018-04-25, released 2019-05-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Adenosylmethionine-8-amino-7-oxononanoate aminotransferase
    Species: Mycobacterium microti [TaxId:1806]
    Gene: bioA, RN08_1757
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ge8a_
  • Chain 'B':
    Compound: Adenosylmethionine-8-amino-7-oxononanoate aminotransferase
    Species: Mycobacterium microti [TaxId:1806]
    Gene: bioA, RN08_1757
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ge8b_
  • Heterogens: EWE, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ge8A (A:)
    mgsshhhhhhssglvprgshmaaatggltpeqiiavdgahlwhpyssigreavspvvava
    ahgawltlirdgqpievldamsswwtaihghghpaldqalttqlrvmnhvmfgglthepa
    arlakllvditpagldtvffsdsgsvsvevaakmalqywrgrglpgkrrlmtwrggyhgd
    tflamsicdphggmhslwtdvlaaqvfapqvprdydpaysaafeaqlaqhagelaavvve
    pvvqgaggmrfhdprylhdlrdicrryevllifdeiatgfgrtgalfaadhagvspdimc
    vgkaltggylslaatlctadvahtisagaagalmhgptfmanplacavsvasvelllgqd
    wrtritelaagltagldtaralpavtdvrvcgaigviecdrpvdlavatpaaldrgvwlr
    pfrnlvyamppyictpaeitqitsamvevarlvgslp
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ge8A (A:)
    gltpeqiiavdgahlwhpyssigreavspvvavaahgawltlirdgqpievldamsswwt
    aihghghpaldqalttqlrvmnhvmfgglthepaarlakllvditpagldtvffsdsgsv
    svevaakmalqywrgrglpgkrrlmtwrggyhgdtflamsicdphggmhlaaqvfapqvp
    rdydpaysaafeaqlaqhagelaavvvepvvqgaggmrfhdprylhdlrdicrryevlli
    fdeiatgfgrtgalfaadhagvspdimcvgkaltggylslaatlctadvahtisagaaga
    lmhgptfmanplacavsvasvelllgqdwrtritelaagltagldtaralpavtdvrvcg
    aigviecdrpvdlavatpaaldrgvwlrpfrnlvyamppyictpaeitqitsamvevarl
    vg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6ge8B (B:)
    mgsshhhhhhssglvprgshmaaatggltpeqiiavdgahlwhpyssigreavspvvava
    ahgawltlirdgqpievldamsswwtaihghghpaldqalttqlrvmnhvmfgglthepa
    arlakllvditpagldtvffsdsgsvsvevaakmalqywrgrglpgkrrlmtwrggyhgd
    tflamsicdphggmhslwtdvlaaqvfapqvprdydpaysaafeaqlaqhagelaavvve
    pvvqgaggmrfhdprylhdlrdicrryevllifdeiatgfgrtgalfaadhagvspdimc
    vgkaltggylslaatlctadvahtisagaagalmhgptfmanplacavsvasvelllgqd
    wrtritelaagltagldtaralpavtdvrvcgaigviecdrpvdlavatpaaldrgvwlr
    pfrnlvyamppyictpaeitqitsamvevarlvgslp
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ge8B (B:)
    gltpeqiiavdgahlwhpyssigreavspvvavaahgawltlirdgqpievldamsswwt
    aihghghpaldqalttqlrvmnhvmfgglthepaarlakllvditpagldtvffsdsgsv
    svevaakmalqywrgrglpgkrrlmtwrggyhgdtflamsicdphgvlaaqvfapqvprd
    ydpaysaafeaqlaqhagelaavvvepvvqgaggmrfhdprylhdlrdicrryevllifd
    eiatgfgrtgalfaadhagvspdimcvgkaltggylslaatlctadvahtisagaagalm
    hgptfmanplacavsvasvelllgqdwrtritelaagltagldtaralpavtdvrvcgai
    gviecdrpvdlavatpaaldrgvwlrpfrnlvyamppyictpaeitqitsamvevarlvg