PDB entry 6ge7

View 6ge7 on RCSB PDB site
Description: Thermodynamic, Crystallographic and Computational Studies of Non Mammalian Fatty Acid Binding to Bovine b-Lactoglobulin
Class: transport protein
Keywords: lactoglobulin, fatty acid, Non-Mammalian, transport protein
Deposited on 2018-04-25, released 2018-06-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-07-11, with a file datestamp of 2018-07-06.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: beta-lactoglobulin
  Species: Bos taurus [TaxId:9913]
  Gene: LGB
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02754 (0-161)
  Domains in SCOPe 2.08: d6ge7a_
• Heterogens: EW8, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6ge7A (A:)
  livtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqk
  wengecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslacq
  clvrtpevddealekfdkalkalpmhirlsfnptqleeqchi