PDB entry 6ge6

View 6ge6 on RCSB PDB site
Description: X-ray structure of TEAD4(E263A+Y429F mutant) complexed with YAP(wildtype): The role of residual flexibility and water molecules in the adaptation of a bound intrinsically disordered protein to mutations at a binding interface
Class: transcription
Keywords: transcription factor, co-activator, transcription regulation, TRANSCRIPTION
Deposited on 2018-04-25, released 2018-09-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-10-31, with a file datestamp of 2018-10-26.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional enhancer factor TEF-3
    Species: Homo sapiens [TaxId:9606]
    Gene: TEAD4, RTEF1, TCF13L1, TEF3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15561 (0-218)
      • engineered mutation (47)
      • engineered mutation (213)
    Domains in SCOPe 2.08: d6ge6a_
  • Chain 'L':
    Compound: Transcriptional coactivator YAP1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MYR, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6ge6A (A:)
grsvassklwmlefsafleqqqdpdtynkhlfvhigqsspsysdpylaavdirqiydkfp
ekkgglkdlfergpsnafflvkfwadlntniedegssfygvssqyespenmiitcstkvc
sfgkqvvekveteyaryenghysyrihrsplceyminfihklkhlpekymmnsvlenfti
lqvvtnrdtqetllciayvfevsasehgaqhhifrlvke

    Sequence, based on observed residues (ATOM records): (download) 
    >6ge6A (A:)
grsvassklwmlefsafleqqqdpdtynkhlfvhigqsspsysdpylaavdirqiydkfp
ekkgglkdlfergpsnafflvkfwadlntnssfygvssqyespenmiitcstkvcsfgkq
vvekveteyaryenghysyrihrsplceyminfihklkhlpekymmnsvlenftilqvvt
nrdtqetllciayvfevsasehgaqhhifrlvke

  • Chain 'L':
    No sequence available.