PDB entry 6ge4

View 6ge4 on RCSB PDB site
Description: tead4 (216-434);e263a complexed with yap peptide (60-100) and myristoate (covalently bound) at 1.97a (p41212 crystal form); myristoylation was done by adding myr-coa
Class: transcription
Keywords: transcription, co-activator, protein-protein interaction
Deposited on 2018-04-25, released 2018-09-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-10-31, with a file datestamp of 2018-10-26.
Experiment type: XRAY
Resolution: 1.97 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional enhancer factor TEF-3
    Species: Homo sapiens [TaxId:9606]
    Gene: TEAD4, RTEF1, TCF13L1, TEF3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15561 (Start-218)
      • engineered mutation (47)
    Domains in SCOPe 2.08: d6ge4a_
  • Chain 'L':
    Compound: Transcriptional coactivator YAP1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MYR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ge4A (A:)
    grsvassklwmlefsafleqqqdpdtynkhlfvhigqsspsysdpylaavdirqiydkfp
    ekkgglkdlfergpsnafflvkfwadlntniedegssfygvssqyespenmiitcstkvc
    sfgkqvvekveteyaryenghysyrihrsplceyminfihklkhlpekymmnsvlenfti
    lqvvtnrdtqetllciayvfevsasehgaqhhiyrlvke
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ge4A (A:)
    rsvassklwmlefsafleqqqdpdtynkhlfvhigdpylaavdirqiydkfpekkgglkd
    lfergpsnafflvkfwadlntnigssfygvssqyespenmiitcstkvcsfgkqvvekve
    teyaryenghysyrihrsplceyminfihklkhlpekymmnsvlenftilqvvtnrdtqe
    tllciayvfevsasehgaqhhiyrlvke
    

  • Chain 'L':
    No sequence available.