PDB entry 6ge2

View 6ge2 on RCSB PDB site
Description: exendin-4 based dual glp-1/glucagon receptor agonist
Deposited on 2018-04-25, released 2018-06-20
The last revision was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Exendin-4
    Species: Heloderma suspectum, synthetic [TaxId:8554]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26349 (0-38)
      • conflict (1-2)
      • conflict (13-14)
      • conflict (16-19)
      • conflict (26-27)
      • conflict (31)
      • conflict (33-34)
      • conflict (38)
  • Heterogens: EVT

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6ge2A (A:)
    haqgtftsdlskqkdeqraklfiewlaaggppsakpppk