PDB entry 6gdy

View 6gdy on RCSB PDB site
Description: crystal structure of 2og oxygenase jmjd6 (aa 1-343) in complex with fe(ii) and 2og
Deposited on 2018-04-24, released 2019-04-03
The last revision was dated 2019-10-16, with a file datestamp of 2019-10-11.
Experiment type: XRAY
Resolution: 2.04 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6
    Species: Homo sapiens [TaxId:9606]
    Gene: JMJD6, KIAA0585, PTDSR
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6
    Species: Homo sapiens [TaxId:9606]
    Gene: JMJD6, KIAA0585, PTDSR
    Database cross-references and differences (RAF-indexed):
  • Heterogens: FE, AKG, NA, PO4, EPE, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6gdyA (A:)
    mnhkskkrireakrsarpelkdsldwtrhnyyesfslspaavadnveradalqlsveefv
    eryerpykpvvllnaqegwsaqekwtlerlkrkyrnqkfkcgedndgysvkmkmkyyiey
    mestrddsplyifdssygehpkrrklledykvpkfftddlfqyagekrrppyrwfvmgpp
    rsgtgihidplgtsawnalvqghkrwclfptstprelikvtrdeggnqqdeaitwfnviy
    prtqlptwppefkpleilqkpgetvfvpggwwhvvlnldttiaitqnfasstnfpvvwhk
    tvrgrpklsrkwyrilkqehpelavladsvdlqestgiasdss
    

    Sequence, based on observed residues (ATOM records):
    >6gdyA (A:)
    mnhkskkrireakrsarpelkdsldwtrhnyyesfslspaavadnveradalqlsveefv
    eryerpykpvvllnaqegwsaqekwtlerlkrkyrnqkfkcgedndgysvkmkmkyyiey
    mestrddsplyifdssygehpkrrklledykvpkfftddlfqyagekrrppyrwfvmgpp
    rsgtgihidplgtsawnalvqghkrwclfptstprelikvtrdeggnqqdeaitwfnviy
    prtqlptwppefkpleilqkpgetvfvpggwwhvvlnldttiaitqnfasstnfpvvwhk
    tvrgrpklsrkwyrilkqehpelavladsvdlqe
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6gdyB (B:)
    mnhkskkrireakrsarpelkdsldwtrhnyyesfslspaavadnveradalqlsveefv
    eryerpykpvvllnaqegwsaqekwtlerlkrkyrnqkfkcgedndgysvkmkmkyyiey
    mestrddsplyifdssygehpkrrklledykvpkfftddlfqyagekrrppyrwfvmgpp
    rsgtgihidplgtsawnalvqghkrwclfptstprelikvtrdeggnqqdeaitwfnviy
    prtqlptwppefkpleilqkpgetvfvpggwwhvvlnldttiaitqnfasstnfpvvwhk
    tvrgrpklsrkwyrilkqehpelavladsvdlqestgiasdss
    

    Sequence, based on observed residues (ATOM records):
    >6gdyB (B:)
    mnhkskkrireakrsarpelkdsldwtrhnyyesfslspaavadnveradalqlsveefv
    eryerpykpvvllnaqegwsaqekwtlerlkrkyrnqkfkcgedndgysvkmkmkyyiey
    mestrddsplyifdssygehpkrrklledykvpkfftddlfqyagekrrppyrwfvmgpp
    rsgtgihidplgtsawnalvqghkrwclfptstprelikvtrdeggnqqdeaitwfnviy
    prtqlptwppefkpleilqkpgetvfvpggwwhvvlnldttiaitqnfasstnfpvvwhk
    tvrgrpklsrkwyrilkqehpelavladsvdlqe