PDB entry 6gdu

View 6gdu on RCSB PDB site
Description: structure of cuta from synechococcus elongatus pcc7942
Deposited on 2018-04-24, released 2019-05-08
The last revision was dated 2021-06-02, with a file datestamp of 2021-05-28.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Periplasmic divalent cation tolerance protein
    Species: Synechococcus elongatus (strain PCC 7942) [TaxId:1140]
    Gene: Synpcc7942_2261
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Periplasmic divalent cation tolerance protein
    Species: Synechococcus elongatus (strain PCC 7942) [TaxId:1140]
    Gene: Synpcc7942_2261
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Periplasmic divalent cation tolerance protein
    Species: Synechococcus elongatus (strain PCC 7942) [TaxId:1140]
    Gene: Synpcc7942_2261
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6gduA (A:)
    mgsshhhhhhssglvprgshmtdlsslietadlrlllttvsteveaqqlaqaaveaglaa
    cvsitpiqscyrwqgaiareteqqmsfkttveqldalqqwlqsqhpyalpeclvltpias
    svayrdwlrssls
    

    Sequence, based on observed residues (ATOM records):
    >6gduA (A:)
    tdlsslietadlrlllttvsteveaqqlaqaaveaglaacvsitpiqscyrwqgaiaret
    eqqmsfkttveqldalqqwlqsqhpyalpeclvltpiassvayrdwlrssls
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6gduB (B:)
    mgsshhhhhhssglvprgshmtdlsslietadlrlllttvsteveaqqlaqaaveaglaa
    cvsitpiqscyrwqgaiareteqqmsfkttveqldalqqwlqsqhpyalpeclvltpias
    svayrdwlrssls
    

    Sequence, based on observed residues (ATOM records):
    >6gduB (B:)
    slietadlrlllttvsteveaqqlaqaaveaglaacvsitpiqscyrwqgaiareteqqm
    sfkttveqldalqqwlqsqhpyalpeclvltpiassvayrdwlrssls
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >6gduC (C:)
    mgsshhhhhhssglvprgshmtdlsslietadlrlllttvsteveaqqlaqaaveaglaa
    cvsitpiqscyrwqgaiareteqqmsfkttveqldalqqwlqsqhpyalpeclvltpias
    svayrdwlrssls
    

    Sequence, based on observed residues (ATOM records):
    >6gduC (C:)
    slietadlrlllttvsteveaqqlaqaaveaglaacvsitpiqscyrwqgaiareteqqm
    sfkttveqldalqqwlqsqhpyalpeclvltpiassvayrdwlrssl