PDB entry 6gdt

View 6gdt on RCSB PDB site
Description: crystal structure of exo-glucosidase/glucosaminidase vc0615 from vibrio cholerae
Deposited on 2018-04-24, released 2018-08-15
The last revision was dated 2018-08-15, with a file datestamp of 2018-08-10.
Experiment type: XRAY
Resolution: 3.17 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endoglucanase-related protein
    Species: Vibrio cholerae O1 biovar El Tor str. N16961 [TaxId:243277]
    Gene: VC_0615
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Endoglucanase-related protein
    Species: Vibrio cholerae O1 biovar El Tor str. N16961 [TaxId:243277]
    Gene: VC_0615
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Endoglucanase-related protein
    Species: Vibrio cholerae O1 biovar El Tor str. N16961 [TaxId:243277]
    Gene: VC_0615
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Endoglucanase-related protein
    Species: Vibrio cholerae O1 biovar El Tor str. N16961 [TaxId:243277]
    Gene: VC_0615
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Endoglucanase-related protein
    Species: Vibrio cholerae O1 biovar El Tor str. N16961 [TaxId:243277]
    Gene: VC_0615
    Database cross-references and differences (RAF-indexed):
  • Heterogens: EDO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6gdtA (A:)
    mllltnhigyetqgpkqavllcgqtqlmddcvllvcarshqtvaklaiewhgkvdnwhqg
    qfhridfsdfttpgdyylrlehthsatftiargvlmqrtfsdvlhyfksqrcsgqfdqqd
    kqvpllststtadvhggwydasgdvskylshlsyanylnpqqtplvvwnmlkglavlqhh
    sgfasfsrtrlkdealfgadflrrmqnsegffymtvfdkwskdtkqreicayatqqghks
    ddyqagfrqgggmaiaalaaaarldthgeftqadylqaaengywhlkehnlaylndgven
    iideycallaccelyrttendqylaqarewaqrlakrqcsdeqiahywsatsngerpyfh
    asdaglpvialceylnietdtanyaqlqrvveqacqfelaitqqvsnpfgyprqyvkgve
    sakrtsffiaqdnesgywwqgenarlaslasmaylaqphlstaiakpleqwsqnalnwiv
    glnpynmcmldghghnnpdylphlgffnakggvcngitagfddprdiafnpagqkddmlq
    nwrwgeqwiphgawyllaiisqfahftahgeenqlehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >6gdtA (A:)
    mllltnhigyetqgpkqavllcgqtqlmddcvllvcarshqtvaklaiewhgkvdnwhqg
    qfhridfsdfttpgdyylrlehthsatftiargvlmqrtfsdvlhyfksqrcsgqfdqqd
    kqvpllststtadvhggwydasgdvskylshlsyanylnpqqtplvvwnmlkglavlqhh
    sgfasfsrtrlkdealfgadflrrmqnsegffymtvfdkwskdtkqreicayatqqghks
    ddyqagfrqgggmaiaalaaaarldthgeftqadylqaaengywhlkehnlaylndgven
    iideycallaccelyrttendqylaqarewaqrlakrqcsdeqiahywsatsngerpyfh
    asdaglpvialceylnietdtanyaqlqrvveqacqfelaitqqvsnpfgyprqyvkgve
    sakrtsffiaqdnesgywwqgenarlaslasmaylaqphlstaiakpleqwsqnalnwiv
    glnpynmcmldghghnnpdylphlgffnakggvcngitagfddprdiafnpagqkddmlq
    nwrwgeqwiphgawyllaiisqfahf
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6gdtB (B:)
    mllltnhigyetqgpkqavllcgqtqlmddcvllvcarshqtvaklaiewhgkvdnwhqg
    qfhridfsdfttpgdyylrlehthsatftiargvlmqrtfsdvlhyfksqrcsgqfdqqd
    kqvpllststtadvhggwydasgdvskylshlsyanylnpqqtplvvwnmlkglavlqhh
    sgfasfsrtrlkdealfgadflrrmqnsegffymtvfdkwskdtkqreicayatqqghks
    ddyqagfrqgggmaiaalaaaarldthgeftqadylqaaengywhlkehnlaylndgven
    iideycallaccelyrttendqylaqarewaqrlakrqcsdeqiahywsatsngerpyfh
    asdaglpvialceylnietdtanyaqlqrvveqacqfelaitqqvsnpfgyprqyvkgve
    sakrtsffiaqdnesgywwqgenarlaslasmaylaqphlstaiakpleqwsqnalnwiv
    glnpynmcmldghghnnpdylphlgffnakggvcngitagfddprdiafnpagqkddmlq
    nwrwgeqwiphgawyllaiisqfahftahgeenqlehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >6gdtB (B:)
    mllltnhigyetqgpkqavllcgqtqlmddcvllvcarshqtvaklaiewhgkvdnwhqg
    qfhridfsdfttpgdyylrlehthsatftiargvlmqrtfsdvlhyfksqrcsgqfdqqd
    kqvpllststtadvhggwydasgdvskylshlsyanylnpqqtplvvwnmlkglavlqhh
    sgfasfsrtrlkdealfgadflrrmqnsegffymtvfdkwskdtkqreicayatqqghks
    ddyqagfrqgggmaiaalaaaarldthgeftqadylqaaengywhlkehnlaylndgven
    iideycallaccelyrttendqylaqarewaqrlakrqcsdeqiahywsatsngerpyfh
    asdaglpvialceylnietdtanyaqlqrvveqacqfelaitqqvsnpfgyprqyvkgve
    sakrtsffiaqdnesgywwqgenarlaslasmaylaqphlstaiakpleqwsqnalnwiv
    glnpynmcmldghghnnpdylphlgffnakggvcngitagfddprdiafnpagqkddmlq
    nwrwgeqwiphgawyllaiisqfahf
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >6gdtC (C:)
    mllltnhigyetqgpkqavllcgqtqlmddcvllvcarshqtvaklaiewhgkvdnwhqg
    qfhridfsdfttpgdyylrlehthsatftiargvlmqrtfsdvlhyfksqrcsgqfdqqd
    kqvpllststtadvhggwydasgdvskylshlsyanylnpqqtplvvwnmlkglavlqhh
    sgfasfsrtrlkdealfgadflrrmqnsegffymtvfdkwskdtkqreicayatqqghks
    ddyqagfrqgggmaiaalaaaarldthgeftqadylqaaengywhlkehnlaylndgven
    iideycallaccelyrttendqylaqarewaqrlakrqcsdeqiahywsatsngerpyfh
    asdaglpvialceylnietdtanyaqlqrvveqacqfelaitqqvsnpfgyprqyvkgve
    sakrtsffiaqdnesgywwqgenarlaslasmaylaqphlstaiakpleqwsqnalnwiv
    glnpynmcmldghghnnpdylphlgffnakggvcngitagfddprdiafnpagqkddmlq
    nwrwgeqwiphgawyllaiisqfahftahgeenqlehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >6gdtC (C:)
    mllltnhigyetqgpkqavllcgqtqlmddcvllvcarshqtvaklaiewhgkvdnwhqg
    qfhridfsdfttpgdyylrlehthsatftiargvlmqrtfsdvlhyfksqrcsgqfdqqd
    kqvpllststtadvhggwydasgdvskylshlsyanylnpqqtplvvwnmlkglavlqhh
    sgfasfsrtrlkdealfgadflrrmqnsegffymtvfdkwskdtkqreicayatqqghks
    ddyqagfrqgggmaiaalaaaarldthgeftqadylqaaengywhlkehnlaylndgven
    iideycallaccelyrttendqylaqarewaqrlakrqcsdeqiahywsatsngerpyfh
    asdaglpvialceylnietdtanyaqlqrvveqacqfelaitqqvsnpfgyprqyvkgve
    sakrtsffiaqdnesgywwqgenarlaslasmaylaqphlstaiakpleqwsqnalnwiv
    glnpynmcmldghghnnpdylphlgffnakggvcngitagfddprdiafnpagqkddmlq
    nwrwgeqwiphgawyllaiisqfahf
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >6gdtD (D:)
    mllltnhigyetqgpkqavllcgqtqlmddcvllvcarshqtvaklaiewhgkvdnwhqg
    qfhridfsdfttpgdyylrlehthsatftiargvlmqrtfsdvlhyfksqrcsgqfdqqd
    kqvpllststtadvhggwydasgdvskylshlsyanylnpqqtplvvwnmlkglavlqhh
    sgfasfsrtrlkdealfgadflrrmqnsegffymtvfdkwskdtkqreicayatqqghks
    ddyqagfrqgggmaiaalaaaarldthgeftqadylqaaengywhlkehnlaylndgven
    iideycallaccelyrttendqylaqarewaqrlakrqcsdeqiahywsatsngerpyfh
    asdaglpvialceylnietdtanyaqlqrvveqacqfelaitqqvsnpfgyprqyvkgve
    sakrtsffiaqdnesgywwqgenarlaslasmaylaqphlstaiakpleqwsqnalnwiv
    glnpynmcmldghghnnpdylphlgffnakggvcngitagfddprdiafnpagqkddmlq
    nwrwgeqwiphgawyllaiisqfahftahgeenqlehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >6gdtD (D:)
    mllltnhigyetqgpkqavllcgqtqlmddcvllvcarshqtvaklaiewhgkvdnwhqg
    qfhridfsdfttpgdyylrlehthsatftiargvlmqrtfsdvlhyfksqrcsgqfdqqd
    kqvpllststtadvhggwydasgdvskylshlsyanylnpqqtplvvwnmlkglavlqhh
    sgfasfsrtrlkdealfgadflrrmqnsegffymtvfdkwskdtkqreicayatqqghks
    ddyqagfrqgggmaiaalaaaarldthgeftqadylqaaengywhlkehnlaylndgven
    iideycallaccelyrttendqylaqarewaqrlakrqcsdeqiahywsatsngerpyfh
    asdaglpvialceylnietdtanyaqlqrvveqacqfelaitqqvsnpfgyprqyvkgve
    sakrtsffiaqdnesgywwqgenarlaslasmaylaqphlstaiakpleqwsqnalnwiv
    glnpynmcmldghghnnpdylphlgffnakggvcngitagfddprdiafnpagqkddmlq
    nwrwgeqwiphgawyllaiisqfahf
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >6gdtE (E:)
    mllltnhigyetqgpkqavllcgqtqlmddcvllvcarshqtvaklaiewhgkvdnwhqg
    qfhridfsdfttpgdyylrlehthsatftiargvlmqrtfsdvlhyfksqrcsgqfdqqd
    kqvpllststtadvhggwydasgdvskylshlsyanylnpqqtplvvwnmlkglavlqhh
    sgfasfsrtrlkdealfgadflrrmqnsegffymtvfdkwskdtkqreicayatqqghks
    ddyqagfrqgggmaiaalaaaarldthgeftqadylqaaengywhlkehnlaylndgven
    iideycallaccelyrttendqylaqarewaqrlakrqcsdeqiahywsatsngerpyfh
    asdaglpvialceylnietdtanyaqlqrvveqacqfelaitqqvsnpfgyprqyvkgve
    sakrtsffiaqdnesgywwqgenarlaslasmaylaqphlstaiakpleqwsqnalnwiv
    glnpynmcmldghghnnpdylphlgffnakggvcngitagfddprdiafnpagqkddmlq
    nwrwgeqwiphgawyllaiisqfahftahgeenqlehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >6gdtE (E:)
    mllltnhigyetqgpkqavllcgqtqlmddcvllvcarshqtvaklaiewhgkvdnwhqg
    qfhridfsdfttpgdyylrlehthsatftiargvlmqrtfsdvlhyfksqrcsgqfdqqd
    kqvplltadvhggwydasgdvskylshlsyanylnpqqtplvvwnmlkglavlqhhsgfa
    sfsrtrlkdealfgadflrrmqnsegffymtvfdkwskdtkqreicayatqqghksddyq
    agfrqgggmaiaalaaaarldthgeftqadylqaaengywhlkehnlaylndgveniide
    ycallaccelyrttendqylaqarewaqrlakrqcsdeqiahywsatsngerpyfhasda
    glpvialceylnietdtanyaqlqrvveqacqfelaitqqvsnpfgyprqyvkgvesakr
    tsffiaqdnesgywwqgenarlaslasmaylaqphlstaiakpleqwsqnalnwivglnp
    ynmcmldghghnnpdylphlgffnakggvcngitagfddprdiafnpagqkddmlqnwrw
    geqwiphgawyllaiisqfahf