PDB entry 6gdl

View 6gdl on RCSB PDB site
Description: Calmodulin mutant - F141L apo-form Unstructured C-domain
Class: signaling protein
Keywords: Calmodulin, SIGNALING PROTEIN, Calcium signalling
Deposited on 2018-04-23, released 2018-10-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-17, with a file datestamp of 2018-10-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Calmodulin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: Calm1, Calm, Cam, Cam1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gdla_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6gdlA (A:)
adqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgn
gtidfpefltmmarkmkdt