PDB entry 6gd9

View 6gd9 on RCSB PDB site
Description: Cytochrome c in complex with Sulfonato-calix[8]arene, P43212 form
Class: oxidoreductase
Keywords: calixarene, scaffold, supramolecular, assembly, OXIDOREDUCTASE
Deposited on 2018-04-23, released 2018-08-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-10-17, with a file datestamp of 2018-10-12.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Cytochrome c iso-1
  Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
  Gene: CYC1, YJR048W, J1653
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00044 (1-107)
    • expression tag (0)
    • engineered mutation (106)
  Domains in SCOPe 2.08: d6gd9a1, d6gd9a2
• Heterogens: EVB, HEC, EPE, SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6gd9A (A:)
  aefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
  nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkate