PDB entry 6gd8

View 6gd8 on RCSB PDB site
Description: Cytochrome c in complex with Sulfonato-calix[8]arene, P31 form
Class: oxidoreductase
Keywords: calixarene, scaffold, supramolecular, assembly, OXIDOREDUCTASE
Deposited on 2018-04-23, released 2018-08-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-10-17, with a file datestamp of 2018-10-12.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c iso-1
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: CYC1, YJR048W, J1653
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00044 (1-107)
      • expression tag (0)
      • engineered mutation (106)
    Domains in SCOPe 2.08: d6gd8a1, d6gd8a2
  • Chain 'B':
    Compound: Cytochrome c iso-1
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: CYC1, YJR048W, J1653
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00044 (1-107)
      • expression tag (0)
      • engineered mutation (106)
    Domains in SCOPe 2.08: d6gd8b1, d6gd8b2
  • Chain 'C':
    Compound: Cytochrome c iso-1
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: CYC1, YJR048W, J1653
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00044 (1-107)
      • expression tag (0)
      • engineered mutation (106)
    Domains in SCOPe 2.08: d6gd8c1, d6gd8c2
  • Chain 'D':
    Compound: Cytochrome c iso-1
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: CYC1, YJR048W, J1653
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00044 (1-107)
      • expression tag (0)
      • engineered mutation (106)
    Domains in SCOPe 2.08: d6gd8d1, d6gd8d2
  • Heterogens: EVB, HEC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6gd8A (A:)
    aefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
    nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkate
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6gd8B (B:)
    aefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
    nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkate
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6gd8C (C:)
    aefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
    nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkate
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6gd8D (D:)
    aefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
    nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkate