PDB entry 6gd8
View 6gd8 on RCSB PDB site
Description: Cytochrome c in complex with Sulfonato-calix[8]arene, P31 form
Class: oxidoreductase
Keywords: calixarene, scaffold, supramolecular, assembly, OXIDOREDUCTASE
Deposited on
2018-04-23, released
2018-08-29
The last revision prior to the SCOPe 2.08 freeze date was dated
2018-10-17, with a file datestamp of
2018-10-12.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Cytochrome c iso-1
Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
Gene: CYC1, YJR048W, J1653
Database cross-references and differences (RAF-indexed):
- Uniprot P00044 (1-107)
- expression tag (0)
- engineered mutation (106)
Domains in SCOPe 2.08: d6gd8a1, d6gd8a2 - Chain 'B':
Compound: Cytochrome c iso-1
Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
Gene: CYC1, YJR048W, J1653
Database cross-references and differences (RAF-indexed):
- Uniprot P00044 (1-107)
- expression tag (0)
- engineered mutation (106)
Domains in SCOPe 2.08: d6gd8b1, d6gd8b2 - Chain 'C':
Compound: Cytochrome c iso-1
Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
Gene: CYC1, YJR048W, J1653
Database cross-references and differences (RAF-indexed):
- Uniprot P00044 (1-107)
- expression tag (0)
- engineered mutation (106)
Domains in SCOPe 2.08: d6gd8c1, d6gd8c2 - Chain 'D':
Compound: Cytochrome c iso-1
Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
Gene: CYC1, YJR048W, J1653
Database cross-references and differences (RAF-indexed):
- Uniprot P00044 (1-107)
- expression tag (0)
- engineered mutation (106)
Domains in SCOPe 2.08: d6gd8d1, d6gd8d2 - Heterogens: EVB, HEC, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>6gd8A (A:)
aefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkate
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>6gd8B (B:)
aefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkate
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>6gd8C (C:)
aefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkate
- Chain 'D':
Sequence; same for both SEQRES and ATOM records: (download)
>6gd8D (D:)
aefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkate