PDB entry 6gd5

View 6gd5 on RCSB PDB site
Description: the solution structure of the lpta-thanatin complex
Deposited on 2018-04-22, released 2018-11-28
The last revision was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lipopolysaccharide export system protein LptA
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: lptA, yhbN, b3200, JW3167
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Thanatin
    Species: Podisus maculiventris [TaxId:29025]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6gd5A (A:)
vtgdtdqpihiesdqqsldmqgnvvtftgnvivtqgtikinadkvvvtrpggeqgkevid
gygkpatfyqmqdngkpveghasqmhyelakdfvvltgnaylqqvdsnikgdkityl

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >6gd5B (B:)
gskkpvpiiycnrrtgkcqrm