PDB entry 6gcx

View 6gcx on RCSB PDB site
Description: Focal Adhesion Kinase catalytic domain in complex with irreversible inhibitor
Class: cell adhesion
Keywords: Focal Adhesion Kinase Cell Adhesion Signalling Irreversible inhibitor 2, 4-pyrimidine derivatives, CELL ADHESION
Deposited on 2018-04-19, released 2019-05-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-01, with a file datestamp of 2019-04-26.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Focal adhesion kinase 1
    Species: Gallus gallus [TaxId:9031]
    Gene: PTK2, FAK, FAK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gcxa_
  • Heterogens: EUW, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gcxA (A:)
    strdyeiqrerielgrcigegqfgdvhqgiymspenpamavaiktcknctsdsvrekflq
    ealtmrqfdhphivkligvitenpvwiimelctlgelrsflqvrkfsldlaslilyayql
    stalayleskrfvhrdiaarnvlvsatdcvklgdfglsrymedstyykaskgklpikwma
    pesinfrrftsasdvwmfgvcmweilmhgvkpfqgvknndvigriengerlpmppncppt
    lyslmtkcwaydpsrrprftelkaqlstileeeklq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gcxA (A:)
    rdyeiqrerielgrcigegqfgdvhqgiymspenpamavaiktcknsdsvrekflqealt
    mrqfdhphivkligvitenpvwiimelctlgelrsflqvrkfsldlaslilyayqlstal
    ayleskrfvhrdiaarnvlvsatdcvklgdfglsrlpikwmapesinfrrftsasdvwmf
    gvcmweilmhgvkpfqgvknndvigriengerlpmppncpptlyslmtkcwaydpsrrpr
    ftelkaqlstileeeklq