PDB entry 6gck

View 6gck on RCSB PDB site
Description: Trypanosoma brucei PTR1 in complex with inhibitor 1e (F206)
Class: oxidoreductase
Keywords: Trypanosoma brucei, pteridine reductase, PTR1, TbPTR1, benzothiazole, OXIDOREDUCTASE
Deposited on 2018-04-18, released 2019-04-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-03, with a file datestamp of 2019-03-29.
Experiment type: XRAY
Resolution: 2.14 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pteridine reductase
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Gene: PTR1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gcka_
  • Chain 'B':
    Compound: pteridine reductase
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Gene: PTR1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gckb_
  • Chain 'C':
    Compound: pteridine reductase
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Gene: PTR1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gckc_
  • Chain 'D':
    Compound: pteridine reductase
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Gene: PTR1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gckd_
  • Heterogens: NAP, EUB, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gckA (A:)
    meapaavvtgaakrigraiavklhqtgyrvvihyhnsaeaavsladelnkersntavvcq
    adltnsnvlpasceeiinscfrafgrcdvlvnnasafyptplvqgdhednsngktvetqv
    aeligtnaiapflltmsfaqrqkgtnpnctssnlsivnlcdamvdqpcmafslynmgkha
    lvgltqsaalelapygirvngvapgvsllpvamgeeekdkwrrkvplgrreasaeqiada
    viflvsgsaqyitgsiikvdgglslvha
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gckA (A:)
    eapaavvtgaakrigraiavklhqtgyrvvihyhnsaeaavsladelnkersntavvcqa
    dltnsnvlpasceeiinscfrafgrcdvlvnnasafyptplvqgktvetqvaeligtnai
    apflltmsfaqrqksnlsivnlcdamvdqpcmafslynmgkhalvgltqsaalelapygi
    rvngvapgvsllpvamgeeekdkwrrkvplgrreasaeqiadaviflvsgsaqyitgsii
    kvdgglslvha
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6gckB (B:)
    meapaavvtgaakrigraiavklhqtgyrvvihyhnsaeaavsladelnkersntavvcq
    adltnsnvlpasceeiinscfrafgrcdvlvnnasafyptplvqgdhednsngktvetqv
    aeligtnaiapflltmsfaqrqkgtnpnctssnlsivnlcdamvdqpcmafslynmgkha
    lvgltqsaalelapygirvngvapgvsllpvamgeeekdkwrrkvplgrreasaeqiada
    viflvsgsaqyitgsiikvdgglslvha
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gckB (B:)
    meapaavvtgaakrigraiavklhqtgyrvvihyhnsaeaavsladelnkersntavvcq
    adltnsnvlpasceeiinscfrafgrcdvlvnnasafyptplvgktvetqvaeligtnai
    apflltmsfaqrqssnlsivnlcdamvdqpcmafslynmgkhalvgltqsaalelapygi
    rvngvapgvsllpvamgeeekdkwrrkvplgrreasaeqiadaviflvsgsaqyitgsii
    kvdgglslvha
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6gckC (C:)
    meapaavvtgaakrigraiavklhqtgyrvvihyhnsaeaavsladelnkersntavvcq
    adltnsnvlpasceeiinscfrafgrcdvlvnnasafyptplvqgdhednsngktvetqv
    aeligtnaiapflltmsfaqrqkgtnpnctssnlsivnlcdamvdqpcmafslynmgkha
    lvgltqsaalelapygirvngvapgvsllpvamgeeekdkwrrkvplgrreasaeqiada
    viflvsgsaqyitgsiikvdgglslvha
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gckC (C:)
    eapaavvtgaakrigraiavklhqtgyrvvihyhnsaeaavsladelnkersntavvcqa
    dltnsnvlpasceeiinscfrafgrcdvlvnnasafyptplvqktvetqvaeligtnaia
    pflltmsfaqrqssnlsivnlcdamvdqpcmafslynmgkhalvgltqsaalelapygir
    vngvapgvsllpvamgeeekdkwrrkvplgrreasaeqiadaviflvsgsaqyitgsiik
    vdgglslvha
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6gckD (D:)
    meapaavvtgaakrigraiavklhqtgyrvvihyhnsaeaavsladelnkersntavvcq
    adltnsnvlpasceeiinscfrafgrcdvlvnnasafyptplvqgdhednsngktvetqv
    aeligtnaiapflltmsfaqrqkgtnpnctssnlsivnlcdamvdqpcmafslynmgkha
    lvgltqsaalelapygirvngvapgvsllpvamgeeekdkwrrkvplgrreasaeqiada
    viflvsgsaqyitgsiikvdgglslvha
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gckD (D:)
    eapaavvtgaakrigraiavklhqtgyrvvihyhnsaeaavsladelnkersntavvcqa
    dltnsnvlpasceeiinscfrafgrcdvlvnnasafyptplvgktvetqvaeligtnaia
    pflltmsfaqrqsnlsivnlcdamvdqpcmafslynmgkhalvgltqsaalelapygirv
    ngvapgvsllpvamgeeekdkwrrkvplgrreasaeqiadaviflvsgsaqyitgsiikv
    dgglslvha