PDB entry 6gbv

View 6gbv on RCSB PDB site
Description: A fast recovering full-length LOV protein (DsLOV) from the marine phototrophic bacterium Dinoroseobacter shibae (Dark state) - M49T mutant
Class: signaling protein
Keywords: light-oxygen-voltage, lov, pas, signaling protein
Deposited on 2018-04-16, released 2018-07-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-08-22, with a file datestamp of 2018-08-17.
Experiment type: XRAY
Resolution: 1.63 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative blue-light photoreceptor
    Species: Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) [TaxId:398580]
    Gene: Dshi_2006
    Database cross-references and differences (RAF-indexed):
    • Uniprot A8LP63 (Start-137)
      • engineered mutation (48)
      • expression tag (138)
    Domains in SCOPe 2.08: d6gbva1, d6gbva2
  • Heterogens: FMN, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gbvA (A:)
    mrrhyrdlirntpmpdtpqdiadlralldedeaemsvvfsdpsqpdnptiyvsdaflvqt
    gytleevlgrncrflqgpdtnphaveairqglkaetrftidilnyrkdgsafvnrlrirp
    iydpegnlmffagaqnpvlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gbvA (A:)
    diadlralldedeaemsvvfsdpsqpdnptiyvsdaflvqtgytleevlgrncrflqgpd
    tnphaveairqglkaetrftidilnyrkdgsafvnrlrirpiydpegnlmffagaqnpvl