PDB entry 6gbn

View 6gbn on RCSB PDB site
Description: crystal structure of s-adenosyl-l-homocysteine hydrolase from cytophaga hutchinsonii in complex with adenosine
Deposited on 2018-04-15, released 2018-08-08
The last revision was dated 2018-08-08, with a file datestamp of 2018-08-03.
Experiment type: XRAY
Resolution: 2.09 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Adenosylhomocysteinase
    Species: Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) [TaxId:269798]
    Gene: sahH, ahcY, CHU_0610
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Adenosylhomocysteinase
    Species: Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) [TaxId:269798]
    Gene: sahH, ahcY, CHU_0610
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Adenosylhomocysteinase
    Species: Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) [TaxId:269798]
    Gene: sahH, ahcY, CHU_0610
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Adenosylhomocysteinase
    Species: Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) [TaxId:269798]
    Gene: sahH, ahcY, CHU_0610
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ADN, NAD, NA, PG4, PEG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6gbnA (A:)
    snamvdtfvkhkvkdislaawgrkeielaeaempglmsirkefgpskplkgarvagclhm
    tiqtavlietlielgaevtwsscnifstqdhaaaaiaaagisvyawkgmneeefdwcieq
    tlffgedrkplnmilddggdltnmvldrfpelvkdirgiseetttgvlrlkdrerngslv
    lpainindsvtkskfdnkygckeslvdsirratdvmmagkvavvagygdvgkgsaaslrg
    agarvivteidpicalqaamdgyevkkmadavkradivvtatgnkniitgehfkamrdkv
    ivcnighfdneidmawlnktygstkvtvkpqvdiynvdghdviilaegrlvnlgcatghp
    sfvmsssfsnqviaqlelwensskyenkvytlpksldekvarlhlskidveldilsadqa
    ayigvtvdgpykndeyry
    

    Sequence, based on observed residues (ATOM records):
    >6gbnA (A:)
    tfvkhkvkdislaawgrkeielaeaempglmsirkefgpskplkgarvagclhmtiqtav
    lietlielgaevtwsscnifstqdhaaaaiaaagisvyawkgmneeefdwcieqtlffge
    drkplnmilddggdltnmvldrfpelvkdirgiseetttgvlrlkdrerngslvlpaini
    ndsvtkskfdnkygckeslvdsirratdvmmagkvavvagygdvgkgsaaslrgagarvi
    vteidpicalqaamdgyevkkmadavkradivvtatgnkniitgehfkamrdkvivcnig
    hfdneidmawlnktygstkvtvkpqvdiynvdghdviilaegrlvnlgcatghpsfvmss
    sfsnqviaqlelwensskyenkvytlpksldekvarlhlskidveldilsadqaayigvt
    vdgpykndeyry
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6gbnB (B:)
    snamvdtfvkhkvkdislaawgrkeielaeaempglmsirkefgpskplkgarvagclhm
    tiqtavlietlielgaevtwsscnifstqdhaaaaiaaagisvyawkgmneeefdwcieq
    tlffgedrkplnmilddggdltnmvldrfpelvkdirgiseetttgvlrlkdrerngslv
    lpainindsvtkskfdnkygckeslvdsirratdvmmagkvavvagygdvgkgsaaslrg
    agarvivteidpicalqaamdgyevkkmadavkradivvtatgnkniitgehfkamrdkv
    ivcnighfdneidmawlnktygstkvtvkpqvdiynvdghdviilaegrlvnlgcatghp
    sfvmsssfsnqviaqlelwensskyenkvytlpksldekvarlhlskidveldilsadqa
    ayigvtvdgpykndeyry
    

    Sequence, based on observed residues (ATOM records):
    >6gbnB (B:)
    mvdtfvkhkvkdislaawgrkeielaeaempglmsirkefgpskplkgarvagclhmtiq
    tavlietlielgaevtwsscnifstqdhaaaaiaaagisvyawkgmneeefdwcieqtlf
    fgedrkplnmilddggdltnmvldrfpelvkdirgiseetttgvlrlkdrerngslvlpa
    inindsvtkskfdnkygckeslvdsirratdvmmagkvavvagygdvgkgsaaslrgaga
    rvivteidpicalqaamdgyevkkmadavkradivvtatgnkniitgehfkamrdkvivc
    nighfdneidmawlnktygstkvtvkpqvdiynvdghdviilaegrlvnlgcatghpsfv
    msssfsnqviaqlelwensskyenkvytlpksldekvarlhlskidveldilsadqaayi
    gvtvdgpykndeyry
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >6gbnC (C:)
    snamvdtfvkhkvkdislaawgrkeielaeaempglmsirkefgpskplkgarvagclhm
    tiqtavlietlielgaevtwsscnifstqdhaaaaiaaagisvyawkgmneeefdwcieq
    tlffgedrkplnmilddggdltnmvldrfpelvkdirgiseetttgvlrlkdrerngslv
    lpainindsvtkskfdnkygckeslvdsirratdvmmagkvavvagygdvgkgsaaslrg
    agarvivteidpicalqaamdgyevkkmadavkradivvtatgnkniitgehfkamrdkv
    ivcnighfdneidmawlnktygstkvtvkpqvdiynvdghdviilaegrlvnlgcatghp
    sfvmsssfsnqviaqlelwensskyenkvytlpksldekvarlhlskidveldilsadqa
    ayigvtvdgpykndeyry
    

    Sequence, based on observed residues (ATOM records):
    >6gbnC (C:)
    vkhkvkdislaawgrkeielaeaempglmsirkefgpskplkgarvagclhmtiqtavli
    etlielgaevtwsscnifstqdhaaaaiaaagisvyawkgmneeefdwcieqtlffgedr
    kplnmilddggdltnmvldrfpelvkdirgiseetttgvlrlkdrerngslvlpainind
    svtkskfdnkygckeslvdsirratdvmmagkvavvagygdvgkgsaaslrgagarvivt
    eidpicalqaamdgyevkkmadavkradivvtatgnkniitgehfkamrdkvivcnighf
    dneidmawlnktygstkvtvkpqvdiynvdghdviilaegrlvnlgcatghpsfvmsssf
    snqviaqlelwensskyenkvytlpksldekvarlhlskidveldilsadqaayigvtvd
    gpykndeyry
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >6gbnD (D:)
    snamvdtfvkhkvkdislaawgrkeielaeaempglmsirkefgpskplkgarvagclhm
    tiqtavlietlielgaevtwsscnifstqdhaaaaiaaagisvyawkgmneeefdwcieq
    tlffgedrkplnmilddggdltnmvldrfpelvkdirgiseetttgvlrlkdrerngslv
    lpainindsvtkskfdnkygckeslvdsirratdvmmagkvavvagygdvgkgsaaslrg
    agarvivteidpicalqaamdgyevkkmadavkradivvtatgnkniitgehfkamrdkv
    ivcnighfdneidmawlnktygstkvtvkpqvdiynvdghdviilaegrlvnlgcatghp
    sfvmsssfsnqviaqlelwensskyenkvytlpksldekvarlhlskidveldilsadqa
    ayigvtvdgpykndeyry
    

    Sequence, based on observed residues (ATOM records):
    >6gbnD (D:)
    mvdtfvkhkvkdislaawgrkeielaeaempglmsirkefgpskplkgarvagclhmtiq
    tavlietlielgaevtwsscnifstqdhaaaaiaaagisvyawkgmneeefdwcieqtlf
    fgedrkplnmilddggdltnmvldrfpelvkdirgiseetttgvlrlkdrerngslvlpa
    inindsvtkskfdnkygckeslvdsirratdvmmagkvavvagygdvgkgsaaslrgaga
    rvivteidpicalqaamdgyevkkmadavkradivvtatgnkniitgehfkamrdkvivc
    nighfdneidmawlnktygstkvtvkpqvdiynvdghdviilaegrlvnlgcatghpsfv
    msssfsnqviaqlelwensskyenkvytlpksldekvarlhlskidveldilsadqaayi
    gvtvdgpykndeyry