PDB entry 6gbm

View 6gbm on RCSB PDB site
Description: solution structure of fus-rrm bound to stem-loop rna
Deposited on 2018-04-15, released 2019-02-20
The last revision was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: RNA (5'-r(*gp*gp*cp*ap*gp*ap*up*up*ap*cp*ap*ap*up*up*cp*up*ap*up*up*up*gp*cp*c)-3')
  Species: HOMO SAPIENS, synthetic [TaxId:9606]
  
• Chain 'B':
  Compound: RNA-binding protein FUS
  Species: Homo sapiens [TaxId:9606]
  Gene: FUS, TLS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P35637 (4-101)
    • expression tag (0-3)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records:
  

  >6gbmB (B:)
  gshmdnsdnntifvqglgenvtiesvadyfkqigiiktnkktgqpminlytdretgklkg
  eatvsfddppsakaaidwfdgkefsgnpikvsfatrradfnr