PDB entry 6gbk

View 6gbk on RCSB PDB site
Description: Repertoires of functionally diverse enzymes through computational design at epistatic active-site positions
Class: hydrolase
Keywords: Phosphotriesterase, HYDROLASE
Deposited on 2018-04-15, released 2018-10-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-24, with a file datestamp of 2018-10-19.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Parathion hydrolase
    Species: Brevundimonas diminuta [TaxId:293]
    Gene: OPD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A434
      • engineered mutation (23)
      • engineered mutation (46)
      • engineered mutation (75)
      • engineered mutation (80)
      • engineered mutation (87)
      • engineered mutation (151)
      • engineered mutation (154)
      • engineered mutation (172)
      • engineered mutation (183)
      • engineered mutation (191)
      • engineered mutation (207)
      • engineered mutation (223)
      • engineered mutation (238)
      • engineered mutation (243)
      • engineered mutation (262-263)
      • engineered mutation (286)
      • engineered mutation (312)
      • engineered mutation (316-317)
      • engineered mutation (319)
      • engineered mutation (321)
    Domains in SCOPe 2.07: d6gbka_
  • Chain 'B':
    Compound: Parathion hydrolase
    Species: Brevundimonas diminuta [TaxId:293]
    Gene: OPD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A434
      • engineered mutation (23)
      • engineered mutation (46)
      • engineered mutation (75)
      • engineered mutation (80)
      • engineered mutation (87)
      • engineered mutation (151)
      • engineered mutation (154)
      • engineered mutation (172)
      • engineered mutation (183)
      • engineered mutation (191)
      • engineered mutation (207)
      • engineered mutation (223)
      • engineered mutation (238)
      • engineered mutation (243)
      • engineered mutation (262-263)
      • engineered mutation (286)
      • engineered mutation (312)
      • engineered mutation (316-317)
      • engineered mutation (319)
      • engineered mutation (321)
    Domains in SCOPe 2.07: d6gbkb_
  • Heterogens: FMT, ZN, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gbkA (A:)
    tnsgdrintvrgpitiseagftlmhehicgssagflrawpeffgsrdalaekavrglrra
    raagvrtivdvstfdlgrdvellaevseaadvhivaatglwfdpplsmrlrsveeltqff
    lreiqygiedtgiragiikvattgkatpfqervlraaaraslatgvpvtthtdasqrdge
    qqadifesegldpsrvcighsddtddldyltalaargyligldgiphsaiglednasaaa
    llglrswqtrallikalidqgyadqilvsndwlfgfssyvtnimdvldrvnpdgmafipl
    rvipflrekgvpdetletimvdnparflsptlras
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gbkA (A:)
    drintvrgpitiseagftlmhehicgssagflrawpeffgsrdalaekavrglrraraag
    vrtivdvstfdlgrdvellaevseaadvhivaatglwfdpplsmrlrsveeltqfflrei
    qygiedtgiragiikvattgkatpfqervlraaaraslatgvpvtthtdasqrdgeqqad
    ifesegldpsrvcighsddtddldyltalaargyligldgiphsaiglednasaaallgl
    rswqtrallikalidqgyadqilvsndwlfgfssyvtnimdvldrvnpdgmafiplrvip
    flrekgvpdetletimvdnparflspt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6gbkB (B:)
    tnsgdrintvrgpitiseagftlmhehicgssagflrawpeffgsrdalaekavrglrra
    raagvrtivdvstfdlgrdvellaevseaadvhivaatglwfdpplsmrlrsveeltqff
    lreiqygiedtgiragiikvattgkatpfqervlraaaraslatgvpvtthtdasqrdge
    qqadifesegldpsrvcighsddtddldyltalaargyligldgiphsaiglednasaaa
    llglrswqtrallikalidqgyadqilvsndwlfgfssyvtnimdvldrvnpdgmafipl
    rvipflrekgvpdetletimvdnparflsptlras
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gbkB (B:)
    drintvrgpitiseagftlmhehicgssagflrawpeffgsrdalaekavrglrraraag
    vrtivdvstfdlgrdvellaevseaadvhivaatglwfdpplsmrlrsveeltqfflrei
    qygiedtgiragiikvattgkatpfqervlraaaraslatgvpvtthtdasqrdgeqqad
    ifesegldpsrvcighsddtddldyltalaargyligldgiphsaiglednasaaallgl
    rswqtrallikalidqgyadqilvsndwlfgfssyvtnimdvldrvnpdgmafiplrvip
    flrekgvpdetletimvdnparflsptlr