PDB entry 6gbi

View 6gbi on RCSB PDB site
Description: wnt signalling
Deposited on 2018-04-14, released 2018-08-15
The last revision was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: N/A
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ly6/PLAUR domain-containing protein 6
    Species: Homo sapiens [TaxId:9606]
    Gene: LYPD6, UNQ3023/PRO9821
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q86Y78 (2-97)
      • expression tag (0-1)
      • expression tag (98-103)
  • Heterogens: NAG, GOL, SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6gbiA (A:)
etgfkcftcekaadnyecnrwapdiycpretrycytqhtmevtgnsisvtkrcvpleecl
stgcrdseheghkvctsccegnicnlplprnetdatfagtlevl