PDB entry 6gb1

View 6gb1 on RCSB PDB site
Description: crystal structure of the glp1 receptor ecd with peptide 11
Deposited on 2018-04-13, released 2018-06-20
The last revision was dated 2018-07-25, with a file datestamp of 2018-07-20.
Experiment type: XRAY
Resolution: 2.73 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glucagon-like peptide 1 receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: GLP1R
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Peptide 11
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 6GB1 (0-End)
  • Heterogens: SO4, HEZ, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6gb1A (A:)
gshagprpqgatvslwetvqkwreyrrqcqrsltedpppatdlfcnrtfdeyacwpdgep
gsfvnvscpwylpwassvpqghvyrfctaeglwlqkdnsslpwrdlseceeskrgerssp
eeqllfly

    Sequence, based on observed residues (ATOM records):
    >6gb1A (A:)
gatvslwetvqkwreyrrqcqrsltedpppatdlfcnrtfdeyacwpdgepgsfvnvscp
wylpwassvpqghvyrfctaeglwlqkdnsslpwrdlseceeskrge

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >6gb1B (B:)
dlskqldeqcaklfiewlaaggpssgapppc