PDB entry 6ga2

View 6ga2 on RCSB PDB site
Description: Bacteriorhodopsin, dark state, cell 2
Class: membrane protein
Keywords: Membrane protein, proton pump, time-resolved crystallography, free-electron laser
Deposited on 2018-04-11, released 2019-04-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-24, with a file datestamp of 2019-04-19.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bacteriorhodopsin
    Species: Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) [TaxId:64091]
    Gene: bop, VNG_1467G
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ga2a_
  • Heterogens: RET, L2P, TRD, D10, HP6, OCT, MYS, UND, DD9, C14, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ga2A (A:)
    qaqitgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsm
    llgygltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimig
    tglvgaltkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvv
    lwsaypvvwligsegagivplnietllfmvldvsakvgfglillrsraifgeaeapepsa
    gdgaaatsd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ga2A (A:)
    itgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsmllg
    ygltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigtgl
    vgaltkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvlws
    aypvvwligsegagivplnietllfmvldvsakvgfglillrsraifgeae