PDB entry 6ga0

View 6ga0 on RCSB PDB site
Description: crystal structure of a thermophilic o6-alkylguanine-dna alkyltransferase-derived self-labeling protein-tag in covalent complex with snap-vista green
Deposited on 2018-04-11, released 2018-05-09
The last revision was dated 2019-10-23, with a file datestamp of 2019-10-18.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: methylated-DNA--protein-cysteine methyltransferase
    Species: SULFOLOBUS SOLFATARICUS P2 [TaxId:273057]
    Gene: ogt, SSO2487
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97VW7 (13-163)
      • expression tag (11-12)
      • engineered mutation (112)
      • engineered mutation (114)
      • engineered mutation (117-118)
      • engineered mutation (122)
      • engineered mutation (144)
      • expression tag (164)
  • Heterogens: ETW, SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6ga0A (A:)
mrgshhhhhhtdpmlvyglyksplgyitvakddkgfimldfcdcvegnsrddssfteffh
kldlyfegkpinlrepinlktypfrlsvfkevmkipwgkvmtykqiadslgtapaavkta
lsenpilliipchrviaengiggyergvklkrallelegvkipelqvpst

    Sequence, based on observed residues (ATOM records):
    >6ga0A (A:)
dpmlvyglyksplgyitvakddkgfimldfcdcvegnsrddssfteffhkldlyfegkpi
nlrepinlktypfrlsvfkevmkipwgkvmtykqiadslgtapaavktalsenpilliip
chrviaengiggyergvklkrallelegvkipel