PDB entry 6g9z

View 6g9z on RCSB PDB site
Description: Crystal structure of human histidine triad nucleotide-binding protein 1 (hHINT1) crystallized at P212121 space group, with visible extended fragment of N-terminus
Class: hydrolase
Keywords: phosphoramidase, desulfurase, tumour suppressor, HYDROLASE
Deposited on 2018-04-11, released 2018-04-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-18, with a file datestamp of 2018-04-13.
Experiment type: XRAY
Resolution: 1.43 Å
R-factor: N/A
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histidine triad nucleotide-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: HINT1, HINT, PKCI1, PRKCNH1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6g9za_
  • Chain 'B':
    Compound: Histidine triad nucleotide-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: HINT1, HINT, PKCI1, PRKCNH1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6g9zb_
  • Heterogens: LMR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6g9zA (A:)
    madeiakaqvarpggdtifgkiirkeipakiifeddrclafhdispqapthflvipkkhi
    sqisvaedddesllghlmivgkkcaadlglnkgyrmvvnegsdggqsvyhvhlhvlggrq
    mhwppg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g9zA (A:)
    akaqvarpggdtifgkiirkeipakiifeddrclafhdispqapthflvipkkhisqisv
    aedddesllghlmivgkkcaadlglnkgyrmvvnegsdggqsvyhvhlhvlggrqmhwpp
    g
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6g9zB (B:)
    madeiakaqvarpggdtifgkiirkeipakiifeddrclafhdispqapthflvipkkhi
    sqisvaedddesllghlmivgkkcaadlglnkgyrmvvnegsdggqsvyhvhlhvlggrq
    mhwppg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g9zB (B:)
    qvarpggdtifgkiirkeipakiifeddrclafhdispqapthflvipkkhisqisvaed
    ddesllghlmivgkkcaadlglnkgyrmvvnegsdggqsvyhvhlhvlggrqmhwppg