PDB entry 6g9y

View 6g9y on RCSB PDB site
Description: Crystal structure of Aspergillus fumigatus UDP-N-acetylglucosamine pyrophosphorylase in complex with GlcNAc-1P
Class: transferase
Keywords: Aspergillus fumigatus, pyrophosphorylase, UDP-GlcNAc, cell wall, anti fungal, TRANSFERASE
Deposited on 2018-04-11, released 2019-04-24
Made obsolete on 2019-11-06

The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-24, with a file datestamp of 2019-04-19.
Experiment type: XRAY
Resolution: 2.08 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: udp-n-acetylglucosamine pyrophosphorylase
    Species: Aspergillus fumigatus Af293 [TaxId:330879]
    Gene: AFUA_7G02180
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6g9ya_
  • Chain 'B':
    Compound: udp-n-acetylglucosamine pyrophosphorylase
    Species: Aspergillus fumigatus Af293 [TaxId:330879]
    Gene: AFUA_7G02180
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6g9yb_
  • Heterogens: GN1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6g9yA (A:)
    mavaiketvsnfmerfhghpenlprepsaeefqqlrkkytdagqghvfafvdelqtgers
    qlfhqlssfdpvrineladkalnppkaddgpasleplpdiatasildsdpkdleqwyeeg
    lklvagnkvavvlmaggqgtrlgssapkgcfdiglpshkslfqiqaeriaklqllaqris
    gkeavipwyvmtsgptrkpteeffeqhkyfglnksdviifeqgvlpcisnegkilmeskf
    kvavapdgnggiyqalltsgvredmrkrgiehihtycvdnclvkvadpvfigfaaskqvd
    iatkvvrkrnatesvglilqkngkpdvveyseidketaeakdpkqpdvlkfraanivnhy
    ysfkffesielwahklphhvarkkipcikegtgeffkpekpngikleqfvfdvfpmtple
    kfacievrredefsplknargtgeddpdtskrdimsqgqrwiekaggivitegdvvgvev
    splisyggegleflkgreikapafiekee
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g9yA (A:)
    psaeefqqlrkkytdagqghvfafvdelqtgersqlfhqlssfdpvrineladkalnppa
    sleplpdiatasildsdpkdleqwyeeglklvagnkvavvlmaglgssapkgcfdiglps
    hkslfqiqaeriaklqllaqrisgkeavipwyvmtsgptrkpteeffeqhkyfglnksdv
    iifeqgvlpcisnegkilmeskfkvavapdgnggiyqalltsgvredmrkrgiehihtyc
    vdnclvkvadpvfigfaaskqvdiatkvvrkrnatesvglilqkngkpdvveyseidket
    aeakdpkqpdvlkfraanivnhyysfkffesielwahklphhvarkkipcikengikleq
    fvfdvfpmtplekfacievrredefsplknargtgeddpdtskrdimsqgqrwiekaggi
    vitegdvvgvevsplisyggegleflkgreikapafiek
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6g9yB (B:)
    mavaiketvsnfmerfhghpenlprepsaeefqqlrkkytdagqghvfafvdelqtgers
    qlfhqlssfdpvrineladkalnppkaddgpasleplpdiatasildsdpkdleqwyeeg
    lklvagnkvavvlmaggqgtrlgssapkgcfdiglpshkslfqiqaeriaklqllaqris
    gkeavipwyvmtsgptrkpteeffeqhkyfglnksdviifeqgvlpcisnegkilmeskf
    kvavapdgnggiyqalltsgvredmrkrgiehihtycvdnclvkvadpvfigfaaskqvd
    iatkvvrkrnatesvglilqkngkpdvveyseidketaeakdpkqpdvlkfraanivnhy
    ysfkffesielwahklphhvarkkipcikegtgeffkpekpngikleqfvfdvfpmtple
    kfacievrredefsplknargtgeddpdtskrdimsqgqrwiekaggivitegdvvgvev
    splisyggegleflkgreikapafiekee
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g9yB (B:)
    psaeefqqlrkkytdagqghvfafvdelqtgersqlfhqlssfdpvrineladkalnppa
    sleplpdiatasildsdpkdleqwyeeglklvagnkvavvlmaggqgtrlgssapkgcfd
    iglpshkslfqiqaeriaklqllaqrisgkeavipwyvmtsgptrkpteeffeqhkyfgl
    nksdviifeqgvlpcisnegkilmeskfkvavapdgnggiyqalltsgvredmrkrgieh
    ihtycvdnclvkvadpvfigfaaskqvdiatkvvrkrnatesvglilqkngkpdvveyse
    ifraanivnhyysfkffesielwahklphhvarkkipcikkpekpngikleqfvfdvfpm
    tplekfacievrredefsplknargtgeddpdtskrdimsqgqrwiekaggivitegvgv
    evsplisyggegleflkgreikapafiek