PDB entry 6g9w

View 6g9w on RCSB PDB site
Description: Crystal Structure of Aspergillus fumigatus UDP-N-acetylglucosamine pyrophosphorylase in complex with UTP
Class: transferase
Keywords: Aspergillus fumigatus, pyrophosphorylase, catalysis, cell wall, anti fungal, TRANSFERASE
Deposited on 2018-04-11, released 2019-04-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-24, with a file datestamp of 2019-04-19.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: udp-n-acetylglucosamine pyrophosphorylase
    Species: Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) [TaxId:330879]
    Gene: AFUA_7G02180
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6g9wa_
  • Chain 'B':
    Compound: udp-n-acetylglucosamine pyrophosphorylase
    Species: Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) [TaxId:330879]
    Gene: AFUA_7G02180
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6g9wb_
  • Heterogens: UTP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6g9wA (A:)
    mavaiketvsnfmerfhghpenlprepsaeefqqlrkkytdagqghvfafvdelqtgers
    qlfhqlssfdpvrineladkalnppkaddgpasleplpdiatasildsdpkdleqwyeeg
    lklvagnkvavvlmaggqgtrlgssapkgcfdiglpshkslfqiqaeriaklqllaqris
    gkeavipwyvmtsgptrkpteeffeqhkyfglnksdviifeqgvlpcisnegkilmeskf
    kvavapdgnggiyqalltsgvredmrkrgiehihtycvdnclvkvadpvfigfaaskqvd
    iatkvvrkrnatesvglilqkngkpdvveyseidketaeakdpkqpdvlkfraanivnhy
    ysfkffesielwahklphhvarkkipcikegtgeffkpekpngikleqfvfdvfpmtple
    kfacievrredefsplknargtgeddpdtskrdimsqgqrwiekaggivitegdvvgvev
    splisyggegleflkgreikapafiekee
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g9wA (A:)
    psaeefqqlrkkytdagqghvfafvdelqtgersqlfhqlssfdpvrineladkalnppa
    sleplpdiatasildsdpkdleqwyeeglklvagnkvavvlmaggqgtrlgssapkgcfd
    iglpshkslfqiqaeriaklqllaqrisgkeavipwyvmtsgptrkpteeffeqhkyfgl
    nksdviifeqgvlpcisnegkilmeskfkvavapdgnggiyqalltsgvredmrkrgieh
    ihtycvdnclvkvadpvfigfaaskqvdiatkvvrkrnatesvglilqkngkpdvveyse
    idketaeakdpkqpdvlkfraanivnhyysfkffesielwahklphhvarkkicipngik
    leqfvfdvfpmtplekfacievrredefsplknargtgeddpdtskrdimsqgqrwieka
    ggivitegvgvevsplisyggegleflkgreikapafiek
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6g9wB (B:)
    mavaiketvsnfmerfhghpenlprepsaeefqqlrkkytdagqghvfafvdelqtgers
    qlfhqlssfdpvrineladkalnppkaddgpasleplpdiatasildsdpkdleqwyeeg
    lklvagnkvavvlmaggqgtrlgssapkgcfdiglpshkslfqiqaeriaklqllaqris
    gkeavipwyvmtsgptrkpteeffeqhkyfglnksdviifeqgvlpcisnegkilmeskf
    kvavapdgnggiyqalltsgvredmrkrgiehihtycvdnclvkvadpvfigfaaskqvd
    iatkvvrkrnatesvglilqkngkpdvveyseidketaeakdpkqpdvlkfraanivnhy
    ysfkffesielwahklphhvarkkipcikegtgeffkpekpngikleqfvfdvfpmtple
    kfacievrredefsplknargtgeddpdtskrdimsqgqrwiekaggivitegdvvgvev
    splisyggegleflkgreikapafiekee
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g9wB (B:)
    psaeefqqlrkkytdagqghvfafvdelqtgersqlfhqlssfdpvrineladkalnppa
    sleplpdiatasildsdpkdleqwyeeglklvagnkvavvlmaggqgtrlgssapkgcfd
    iglpshkslfqiqaeriaklqllaqrisgkeavipwyvmtsgptrkpteeffeqhkyfgl
    nksdviifeqgvlpcisnegkilmeskfkvavapdgnggiyqalltsgvredmrkrgieh
    ihtycvdnclvkvadpvfigfaaskqvdiatkvvrkrnatesvglilqkngkpdvveyse
    idketaeakdpkqpdvlkfraanivnhyysfkffesielwahklphhvarkkipcikege
    ffkpekpngikleqfvfdvfpmtplekfacievrredefsplknargtgeddpdtskrdi
    msqgqrwiekaggivitgvevsplisyggegleflkgreikapafiek