PDB entry 6g9s

View 6g9s on RCSB PDB site
Description: structural basis for the inhibition of e. coli pbp2
Deposited on 2018-04-11, released 2019-05-22
The last revision was dated 2020-02-05, with a file datestamp of 2020-01-31.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidoglycan D,D-transpeptidase MrdA
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: mrdA, pbpA, b0635, JW0630
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ET5, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6g9sA (A:)
    trsnenriklvpiapsrgiiydrngiplalnrtiyqiemmpekvdnvqqtldalrsvvdl
    tdddiaafrkerarshrftsipvktnltevqvarfavnqyrfpgvevkgykrryypygsa
    lthvigyvskindkdverlnndgklanyaathdigklgieryyedvlhgqtgyeevevnn
    rgrvirqlkevppqaghdiyltldlklqqyietllagsraavvvtdprtggvlalvstps
    ydpnlfvdgisskdysallndpntplvnratqgvyppastvkpyvavsalsagvitrntt
    lfdpgwwqlpgsekryrdwkkwghgrlnvtrsleesadtffyqvaydmgidrlsewmgkf
    gyghytgidlaeersgnmptrewkqkrfkkpwyqgdtipvgigqgywtatpiqmskalmi
    lindgivkvphllmstaedgkqvpwvqpheppvgdihsgywelakdgmygvanrpngtah
    kyfasapykiaaksgtaqvfglkanetynahkiaerlrdhklmtafapynnpqvavamil
    enggagpavgtlmrqildhimlgdnntdlpaenpavaaaedh
    

    Sequence, based on observed residues (ATOM records):
    >6g9sA (A:)
    nriklvpiapsrgiiydrngiplalnrtiyqiemmpekvdnvqqtldalrsvvdltdddi
    aafrkerarshrftsipvktnltevqvarfavnqyrfpgvevkgykrryypygsalthvi
    gyvskindkdverlnndgklanyaathdigklgieryyedvlhgqtgyeevevnnrgrvi
    rqlkevppqaghdiyltldlklqqyietllagsraavvvtdprtggvlalvstpsydpnl
    fvdgisskdysallndpntplvnratqgvyppastvkpyvavsalsagvitrnttlfdpg
    wwqlpgsekryrdwkkwghgrlnvtrsleesadtffyqvaydmgidrlsewmgkfgyghy
    tgidlaeersgnmptrewkqkrfkkpwyqgdtipvgigqgywtatpiqmskalmilindg
    ivkvphllmstaedgkqvpwvqpheppvgdihsgywelakdgmygvanrpngtahkyfas
    apykiaaksgtaqrdhklmtafapynnpqvavamilenggagpavgtlmrqildhiml