PDB entry 6g99

View 6g99 on RCSB PDB site
Description: solution structure of fus-znf bound to uggug
Deposited on 2018-04-10, released 2019-02-20
The last revision was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA (5'-r(*up*gp*gp*up*g)-3')
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
  • Chain 'B':
    Compound: RNA-binding protein FUS
    Species: Homo sapiens [TaxId:9606]
    Gene: FUS, TLS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35637 (5-40)
      • expression tag (0-4)
  • Heterogens: ZN

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >6g99B (B:)
    gplgsgqqragdwkcpnptcenmnfswrnecnqckapkpdg