PDB entry 6g98

View 6g98 on RCSB PDB site
Description: Three dimensional structure of human carbonic anhydrase IX in complex with sulfonamide
Class: lyase
Keywords: lyase
Deposited on 2018-04-10, released 2018-07-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-04, with a file datestamp of 2018-06-29.
Experiment type: XRAY
Resolution: 2.47 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carbonic anhydrase 9
    Species: Homo sapiens [TaxId:9606]
    Gene: CA9, G250, MN
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16790 (Start-256)
      • engineered mutation (39)
    Domains in SCOPe 2.07: d6g98a_
  • Chain 'B':
    Compound: Carbonic anhydrase 9
    Species: Homo sapiens [TaxId:9606]
    Gene: CA9, G250, MN
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16790 (Start-256)
      • engineered mutation (39)
    Domains in SCOPe 2.07: d6g98b_
  • Chain 'C':
    Compound: Carbonic anhydrase 9
    Species: Homo sapiens [TaxId:9606]
    Gene: CA9, G250, MN
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16790 (Start-256)
      • engineered mutation (39)
    Domains in SCOPe 2.07: d6g98c_
  • Chain 'D':
    Compound: Carbonic anhydrase 9
    Species: Homo sapiens [TaxId:9606]
    Gene: CA9, G250, MN
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16790 (Start-256)
      • engineered mutation (39)
    Domains in SCOPe 2.07: d6g98d_
  • Heterogens: ER5, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6g98A (A:)
    gpdqshwryggdppwprvspacagrfqspvdirpqlaafspalrplellgfqlpplpelr
    lrnnghsvqltlppglemalgpgreyralqlhlhwgaagrpgsehtveghrfpaeihvvh
    lstafarvdealgrpgglavlaafleegpeensayeqllsrleeiaeegsetqvpgldis
    allpsdfsryfqyegslttppcaqgviwtvfnqtvmlsakqlhtlsdtlwgpgdsrlqln
    fratqplngrvieasfp
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g98A (A:)
    rvspacagrfqspvdirpqlaafspalrplellgfqlpplpelrlrnnghsvqltlppgl
    emalgpgreyralqlhlhwgaagrpgsehtveghrfpaeihvvhlstafarvdealgrpg
    glavlaafleegpeensayeqllsrleeiaeegsetqvpgldisallpsdfsryfqyegs
    lttppcaqgviwtvfnqtvmlsakqlhtlsdtlwgpgdsrlqlnfratqplngrvieasf
    p
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6g98B (B:)
    gpdqshwryggdppwprvspacagrfqspvdirpqlaafspalrplellgfqlpplpelr
    lrnnghsvqltlppglemalgpgreyralqlhlhwgaagrpgsehtveghrfpaeihvvh
    lstafarvdealgrpgglavlaafleegpeensayeqllsrleeiaeegsetqvpgldis
    allpsdfsryfqyegslttppcaqgviwtvfnqtvmlsakqlhtlsdtlwgpgdsrlqln
    fratqplngrvieasfp
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g98B (B:)
    wprvspacagrfqspvdirpqlaafspalrplellgfqlpplpelrlrnnghsvqltlpp
    glemalgpgreyralqlhlhwgaagrpgsehtveghrfpaeihvvhlstafarvdealgr
    pgglavlaafleegpeensayeqllsrleeiaeegsetqvpgldisallpsdfsryfqye
    gslttppcaqgviwtvfnqtvmlsakqlhtlsdtlwgpgdsrlqlnfratqplngrviea
    sfp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6g98C (C:)
    gpdqshwryggdppwprvspacagrfqspvdirpqlaafspalrplellgfqlpplpelr
    lrnnghsvqltlppglemalgpgreyralqlhlhwgaagrpgsehtveghrfpaeihvvh
    lstafarvdealgrpgglavlaafleegpeensayeqllsrleeiaeegsetqvpgldis
    allpsdfsryfqyegslttppcaqgviwtvfnqtvmlsakqlhtlsdtlwgpgdsrlqln
    fratqplngrvieasfp
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g98C (C:)
    spacagrfqspvdirpqlaafspalrplellgfqlpplpelrlrnnghsvqltlppglem
    algpgreyralqlhlhwgaagrpgsehtveghrfpaeihvvhlstafarvdealgrpggl
    avlaafleegpeensayeqllsrleeiaeegsetqvpgldisallpsdfsryfqyegslt
    tppcaqgviwtvfnqtvmlsakqlhtlsdtlwgpgdsrlqlnfratqplngrvieasfp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6g98D (D:)
    gpdqshwryggdppwprvspacagrfqspvdirpqlaafspalrplellgfqlpplpelr
    lrnnghsvqltlppglemalgpgreyralqlhlhwgaagrpgsehtveghrfpaeihvvh
    lstafarvdealgrpgglavlaafleegpeensayeqllsrleeiaeegsetqvpgldis
    allpsdfsryfqyegslttppcaqgviwtvfnqtvmlsakqlhtlsdtlwgpgdsrlqln
    fratqplngrvieasfp
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g98D (D:)
    spacagrfqspvdirpqlaafspalrplellgfqlpplpelrlrnnghsvqltlppglem
    algpgreyralqlhlhwgaagrpgsehtveghrfpaeihvvhlstafarvdealgrpggl
    avlaafleegpeensayeqllsrleeiaeegsetqvpgldisallpsdfsryfqyegslt
    tppcaqgviwtvfnqtvmlsakqlhtlsdtlwgpgdsrlqlnfratqplngrvieasfp