PDB entry 6g8y

View 6g8y on RCSB PDB site
Description: crystal structures of the single pdz domains from grasp65 and their interaction with the golgin gm130
Deposited on 2018-04-10, released 2019-04-24
The last revision was dated 2020-05-06, with a file datestamp of 2020-05-01.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acetylated cis-Golgi protein, involved in ER-to-Golgi transport
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: GRH1, SCKG_0028
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A250W7Q1 (14-91)
      • expression tag (0-13)
  • Heterogens: EDO, CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6g8yA (A:)
ddddkmlevlfqgpglrivwvdemqfqlqsffdyivgfnddpvpvvsnqhgfsypdyrri
tsifnehcgrtlkvniwsakggtfrdeyisii