PDB entry 6g8x

View 6g8x on RCSB PDB site
Description: Fragment-based discovery of a highly potent, orally bioavailable inhibitor which modulates the phosphorylation and catalytic activity of ERK1/2
Class: signaling protein
Keywords: Erk2 Kinase inhibitor, SIGNALING PROTEIN
Deposited on 2018-04-10, released 2018-05-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-06-27, with a file datestamp of 2018-06-22.
Experiment type: XRAY
Resolution: 1.7600000000000002 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK1, ERK2, PRKM1, PRKM2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6g8xa_
  • Heterogens: EQT, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6g8xA (A:)
    mahhhhhhmaaaaaagagpemvrgqvfdvgprytnlsyigegaygmvcsaydnvnkvrva
    ikkispfehqtycqrtlreikillrfrheniigindiiraptieqmkdvyivqdlmetdl
    ykllktqhlsndhicyflyqilrglkyihsanvlhrdlkpsnlllnttcdlkicdfglar
    vadpdhdhtgflteyvatrwyrapeimlnskgytksidiwsvgcilaemlsnrpifpgkh
    yldqlnhilgilgspsqedlnciinlkarnyllslphknkvpwnrlfpnadskaldlldk
    mltfnphkrieveqalahpyleqyydpsdepiaeapfkfdmelddlpkeklkelifeeta
    rfqpgyrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g8xA (A:)
    pemvrgqvfdvgprytnlsyigegaygmvcsaydnvnkvrvaikkispfehqtycqrtlr
    eikillrfrheniigindiiraptieqmkdvyivqdlmetdlykllktqhlsndhicyfl
    yqilrglkyihsanvlhrdlkpsnlllnttcdlkicdfglarvadpdhdhtgflteyvat
    rwyrapeimlnskgytksidiwsvgcilaemlsnrpifpgkhyldqlnhilgilgspsqe
    dlnciinlkarnyllslphknkvpwnrlfpnadskaldlldkmltfnphkrieveqalah
    pyleqyydpsdepiaeapflpkeklkelifeetarfqpg