PDB entry 6g8v

View 6g8v on RCSB PDB site
Description: Crystal structure of the light chain of botulinum neurotoxin X (residues 2-442)
Class: toxin
Keywords: neurotoxin, endopeptidase, TOXIN
Deposited on 2018-04-10, released 2019-07-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-31, with a file datestamp of 2019-07-26.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: N/A
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Light chain of botulinum neurotoxin X (res. 2-442)
    Species: Clostridium botulinum [TaxId:1491]
    Database cross-references and differences (RAF-indexed):
    • PDB 6G8V
    Domains in SCOPe 2.07: d6g8va_
  • Heterogens: ZN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6g8vA (A:)
    mkkhhhhhhgslvprgskleinkfnyndpidginvitmrpprhsdkinkgkgpfkafqvi
    kniwivperynftnntndlnipsepimeadaiynpnylntpsekdeflqgvikvleriks
    kpegekllelisssiplplvsngaltlsdnetiayqennnivsnlqanlviygpgpdian
    natyglystpisngegtlsevsfspfylkpfdesygnyrslvnivnkfvkrefapdpast
    lmhelvhvthnlygisnrnfyynfdtgkietsrqqnslifeelltfggidskaissliik
    kiietaknnyttliserlntvtvendllkyiknkipvqgrlgnfkldtaefekklntilf
    vlnesnlaqrfsilvrkhylkerpidpiyvnilddnsystlegfnissqgsndfqgqlle
    ssyfekiesnalrafikicprngllynaiyrnsknyln
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g8vA (A:)
    kleinkfnyndpidginvitmrpprhsdkinkgkgpfkafqvikniwivperynftnntn
    dlnipsepimeadaiynpnylntpsekdeflqgvikvlerikskpegekllelisssipl
    plvsngaltlsdnetiayqennnivsnlqanlviygpgpdiannatyglystpisngegt
    lsevsfspfylkpfdesygnyrslvnivnkfvkrefapdpastlmhelvhvthnlygisn
    rnfyynfdtgkietsrqqnslifeelltfggidskaissliikkiietaknnyttliser
    lntvtvendllkyiknkipvqgrlgnfkldtaefekklntilfvlnesnlaqrfsilvrk
    hylkerpidpiyvnilddnsystlegfnissqgsndfqgqllessyfekiesnalrafik
    icp