PDB entry 6g8t

View 6g8t on RCSB PDB site
Description: crystal structures of the single pdz domains from grasp65 and their interaction with the golgin gm130
Deposited on 2018-04-10, released 2019-04-24
The last revision was dated 2020-05-06, with a file datestamp of 2020-05-01.
Experiment type: XRAY
Resolution: 2.67 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Golgi reassembly-stacking protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: GORASP1, GOLPH5, GRASP65
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6g8tA (A:)
mglgvsaeqpaggaegfhlhgvqenspaqqaglepyfdfiitighsrlnkendtlkallk
anvekpvklevfnmktmrvrevevvpsnmwggqgllgasvrfcsfrraseqvwhvldv

    Sequence, based on observed residues (ATOM records):
    >6g8tA (A:)
gaegfhlhgvqenspaqqaglepyfdfiitighsrlnkendtlkallkanvekpvklevf
nmktmrvrevevvpsnmwggqgllgasvrfcsfrraseqvwhvldv