PDB entry 6g8o

View 6g8o on RCSB PDB site
Description: solution structure of the cross-linked sam domain dimer of murine sly1
Deposited on 2018-04-09, released 2019-01-30
The last revision was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SAM and SH3 domain-containing protein 3
    Species: Mus musculus [TaxId:10090]
    Gene: Sash3, Sly
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8K352 (1-68)
      • expression tag (0)
      • engineered mutation (67)
  • Chain 'B':
    Compound: SAM and SH3 domain-containing protein 3
    Species: Mus musculus [TaxId:10090]
    Gene: Sash3, Sly
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8K352 (1-68)
      • expression tag (0)
      • engineered mutation (67)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6g8oA (A:)
gpktlhellerigleehtstlllngyqtledfkelrethlnelnimdpqhraklltaael
lldydtgce

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >6g8oB (B:)
gpktlhellerigleehtstlllngyqtledfkelrethlnelnimdpqhraklltaael
lldydtgce