PDB entry 6g8k

View 6g8k on RCSB PDB site
Description: 14-3-3sigma in complex with a s131beta3s mutated yap ps127 phosphopeptide
Deposited on 2018-04-09, released 2019-04-17
The last revision was dated 2019-12-18, with a file datestamp of 2019-12-13.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: N/A
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 14-3-3 protein sigma
    Species: Homo sapiens [TaxId:9606]
    Gene: SFN, HME1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31947 (5-235)
      • expression tag (0-4)
  • Chain 'P':
    Compound: ace-arg-ala-his-sep-ser-pro-ala-bse-leu-gln
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6G8K
  • Heterogens: CL, MG, NA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6g8kA (A:)
gamgsmerasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggq
raawrvlssieqksneegseekgpevreyrekvetelqgvcdtvlglldshlikeagdae
srvfylkmkgdyyrylaevatgddkkriidsarsayqeamdiskkempptnpirlglaln
fsvfhyeianspeeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwt

  • Chain 'P':
    Sequence, based on SEQRES records:
    >6g8kP (P:)
rahsspaslq

    Sequence, based on observed residues (ATOM records):
    >6g8kP (P:)
ahssp