PDB entry 6g84

View 6g84 on RCSB PDB site
Description: structure of cdc14 bound to cbk1 pxl motif
Deposited on 2018-04-07, released 2018-10-10
The last revision was dated 2018-12-19, with a file datestamp of 2018-12-14.
Experiment type: XRAY
Resolution: 2.47 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein phosphatase CDC14
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: CDC14, OAF3, YFR028C
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Tyrosine-protein phosphatase CDC14
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: CDC14, OAF3, YFR028C
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: cbk1
    Species: SACCHAROMYCES CEREVISIAE, synthetic [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • PDB 6G84 (0-End)
  • Chain 'D':
    Compound: cbk1
    Species: SACCHAROMYCES CEREVISIAE, synthetic [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • PDB 6G84
  • Heterogens: CA, EDO, ZN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6g84A (A:)
    mrrsvyldntieflrgrvylgaydytpedtdelvfftvedaifynsfhldfgpmnighly
    rfavifheilndpenankavvfyssastrqranaacmlccymilvqawtphqvlqplaqv
    dppfmpfrdagysnadfeitiqdvvygvwrakekglidlhsfnlesyekyehvefgdfnv
    ltpdfiafaspqedhpkgylatksshlnqpfksvlnffannnvqlvvrlnshlynkkhfe
    digiqhldlifedgtcpdlsivknfvgaaetiikrggkiavhckaglgrtgcligahliy
    tygftanecigflrfirpgmvvgpqqhwlylhqndfrewkyttrislkpseaigglypli
    sleeyrlqkkklkd
    

    Sequence, based on observed residues (ATOM records):
    >6g84A (A:)
    vyldntieflrgrvylgaydytpedtdelvfftvedaifynsfhldfgpmnighlyrfav
    ifheilndpenankavvfyssastrqranaacmlccymilvqawtphqvlqplaqvdppf
    mpfrdagysnadfeitiqdvvygvwrakekglidlhsfnlesyekyehvefgdfnvltpd
    fiafaspqedhlnqpfksvlnffannnvqlvvrlnshlynkkhfedigiqhldlifedgt
    cpdlsivknfvgaaetiikrggkiavhckaglgrtgcligahliytygftanecigflrf
    irpgmvvgpqqhwlylhqndfrewkyttrislkpseaigglyplisleeyrlqkkk
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6g84B (B:)
    mrrsvyldntieflrgrvylgaydytpedtdelvfftvedaifynsfhldfgpmnighly
    rfavifheilndpenankavvfyssastrqranaacmlccymilvqawtphqvlqplaqv
    dppfmpfrdagysnadfeitiqdvvygvwrakekglidlhsfnlesyekyehvefgdfnv
    ltpdfiafaspqedhpkgylatksshlnqpfksvlnffannnvqlvvrlnshlynkkhfe
    digiqhldlifedgtcpdlsivknfvgaaetiikrggkiavhckaglgrtgcligahliy
    tygftanecigflrfirpgmvvgpqqhwlylhqndfrewkyttrislkpseaigglypli
    sleeyrlqkkklkd
    

    Sequence, based on observed residues (ATOM records):
    >6g84B (B:)
    svyldntieflrgrvylgaydytpedtdelvfftvedaifynsfhldfgpmnighlyrfa
    vifheilndpenankavvfyssastrqranaacmlccymilvqawtphqvlqplaqvdpp
    fmpfrdagysnadfeitiqdvvygvwrakekglidlhsfnlesyekyehvefgdfnvltp
    dfiafaspqedhpkgylatksshlnqpfksvlnffannnvqlvvrlnshlynkkhfedig
    iqhldlifedgtcpdlsivknfvgaaetiikrggkiavhckaglgrtgcligahliytyg
    ftanecigflrfirpgmvvgpqqhwlylhqndfrewkyttrislkpseaigglyplisle
    eyrlqkkk
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >6g84C (C:)
    aftdvpalnypatppph
    

    Sequence, based on observed residues (ATOM records):
    >6g84C (C:)
    aftdvpalnyp
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >6g84D (D:)
    ftdvpalnypatppph
    

    Sequence, based on observed residues (ATOM records):
    >6g84D (D:)
    vpalnyp