PDB entry 6g82

View 6g82 on RCSB PDB site
Description: Serum paraoxonase-1 by directed evolution with the L69S/H115W/F222S mutations
Class: hydrolase
Keywords: beta-propeller, Lactonase, HDL, Organophosphate-hydrolase, HYDROLASE
Deposited on 2018-04-07, released 2019-03-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-20, with a file datestamp of 2019-03-15.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serum paraoxonase-1 by directed evolution with the L69S/H115W/F222S mutations
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6G82 (Start-354)
    Domains in SCOPe 2.07: d6g82a_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6g82A (A:)
    makltaltllgmglalfdrqkssfqtrfnvhrevtpvelpncnlvkgidngsedleilpn
    glafissgskypgimsfdpdksgkillmdlnekepavseleiigntldissfnpwgistf
    idddntvyllvvnhpgssstvevfkfqeeeksllhlktirhkllpsvndivavgpehfya
    tndhyfidpylkswemhlglawsfvtyyspndvrvvaegfdsanginispdgkyvyiael
    lahkihvyekhanwtltplrvlsfdtlvdnisvdpvtgdlwvgchpngmriffydaenpp
    gsevlriqdilseepkvtvvyaengtvlqgstvaavykgklligtvfhkalycdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g82A (A:)
    drqkssfqtrfnvhrevtpvelpncnlvkgidngsedleilpnglafissgskysgkill
    mdlnekepavseleiigntldissfnpwgistfidddntvyllvvnhpgssstvevfkfq
    eeeksllhlktirhkllpsvndivavgpehfyatndhyfidpylkswemhlglawsfvty
    yspndvrvvaegfdsanginispdgkyvyiaellahkihvyekhanwtltplrvlsfdtl
    vdnisvdpvtgdlwvgchpngmriffydaenppgsevlriqdilseepkvtvvyaengtv
    lqgstvaavykgklligtvfhkalycdl