PDB entry 6g81

View 6g81 on RCSB PDB site
Description: solution structure of the ni metallochaperone hypa from helicobacter pylori
Deposited on 2018-04-07, released 2018-10-10
The last revision was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hydrogenase maturation factor HypA
    Species: Helicobacter pylori J99 [TaxId:85963]
    Gene: hypA, jhp_0803
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6g81A (A:)
mheysvvsslialceehakknqahkiervvvgigersamdkslfvsafetfreeslvckd
aildivdekveleckdcshvfkpnaldygvcekchsknviitqgnemrllslemlae