PDB entry 6g7t

View 6g7t on RCSB PDB site
Description: Phosphopantetheine adenylyltransferase from Mycobacterium tuberculosis in complex with 3-(1H-indol-3-yl)propanoic acid at 1.6A resolution.
Class: transferase
Keywords: CoaD, PPAT, Transferase, Complex
Deposited on 2018-04-06, released 2019-04-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-24, with a file datestamp of 2019-04-19.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphopantetheine adenylyltransferase
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: coaD, kdtB, Rv2965c, MTCY349.22, u0002e
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6g7ta_
  • Heterogens: IOP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6g7tA (A:)
    gsmtgavcpgsfdpvtlghvdiferaaaqfdevvvailvnpaktgmfdlderiamvkest
    thlpnlrvqvghglvvdfvrscgmtaivkglrtgtdfeyelqmaqmnkhiagvdtffvat
    aprysfvssslakevamlggdvsellpepvnrrlrdrlntert
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g7tA (A:)
    mtgavcpgsfdpvtlghvdiferaaaqfdevvvailvgmfdlderiamvkestthlpnlr
    vqvghglvvdfvrscgmtaivkglrtgtdfeyelqmaqmnkhiagvdtffvataprysfv
    ssslakevamlggdvsellpepvnrrlrdrln