PDB entry 6g7r

View 6g7r on RCSB PDB site
Description: Structure of fully reduced variant E28Q of E. coli hydrogenase-1 at pH 8
Class: oxidoreductase
Keywords: [NiFe]-Hydrogenase, proton transfer, FeS clusters, hydrogen oxidation, OXIDOREDUCTASE
Deposited on 2018-04-06, released 2019-02-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-27, with a file datestamp of 2019-02-22.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: N/A
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'L':
    Compound: Hydrogenase-1 large chain
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: hyaB, b0973, JW0955
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ACD8 (Start-581)
      • conflict (27)
    Domains in SCOPe 2.07: d6g7rl_
  • Chain 'M':
    Compound: Hydrogenase-1 large chain
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: hyaB, b0973, JW0955
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ACD8 (Start-581)
      • conflict (27)
    Domains in SCOPe 2.07: d6g7rm_
  • Chain 'S':
    Compound: Hydrogenase-1 small chain
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: hyaA, b0972, JW0954
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6g7rs_
  • Chain 'T':
    Compound: Hydrogenase-1 small chain
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: hyaA, b0972, JW0954
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6g7rt_
  • Heterogens: SF4, F3S, SF3, LMT, CL, SO4, EJ2, MG, HOH

PDB Chain Sequences:

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6g7rL (L:)
    mstqyetqgytinnagrrlvvdpitriqghmrcevnindqnvitnavscgtmfrgleiil
    qgrdprdawafvericgvctgvhalasvyaiedaigikvpdnaniirnimlatlwchdhl
    vhfyqlagmdwidvldalkadprktselaqslsswpksspgyffdvqnrlkkfveggqlg
    ifrngywghpqyklppeanlmgfahylealdfqreivkihavfggknphpnwivggmpca
    inidesgavgavnmerlnlvqsiitrtadfinnvmipdalaigqfnkpwseigtglsdkc
    vlsygafpdiandfgeksllmpggavingdfnnvlpvdlvdpqqvqefvdhawyrypndq
    vgrhpfdgitdpwynpgdvkgsdtniqqlneqeryswikaprwrgnamevgplartliay
    hkgdaatvesvdrmmsalnlplsgiqstlgrilcraheaqwaagklqyffdklmtnlkng
    nlatastekwepatwptecrgvgfteaprgalghwaairdgkidlyqcvvpttwnasprd
    pkgqigayeaalmntkmaipeqpleilrtlhsfdpclacsth
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g7rL (L:)
    stqyetqgytinnagrrlvvdpitriqghmrcevnindqnvitnavscgtmfrgleiilq
    grdprdawafvericgvctgvhalasvyaiedaigikvpdnaniirnimlatlwchdhlv
    hfyqlagmdwidvldalkadprktselaqslsswpksspgyffdvqnrlkkfveggqlgi
    frngywghpqyklppeanlmgfahylealdfqreivkihavfggknphpnwivggmpcai
    nidesgavgavnmerlnlvqsiitrtadfinnvmipdalaigqfnkpwseigtglsdkcv
    lsygafpdiandfgeksllmpggavingdfnnvlpvdlvdpqqvqefvdhawyrypndqv
    grhpfdgitdpwynpgdvkgsdtniqqlneqeryswikaprwrgnamevgplartliayh
    kgdaatvesvdrmmsalnlplsgiqstlgrilcraheaqwaagklqyffdklmtnlkngn
    latastekwepatwptecrgvgfteaprgalghwaairdgkidlyqcvvpttwnasprdp
    kgqigayeaalmntkmaipeqpleilrtlhsfdpclacsth
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >6g7rM (M:)
    mstqyetqgytinnagrrlvvdpitriqghmrcevnindqnvitnavscgtmfrgleiil
    qgrdprdawafvericgvctgvhalasvyaiedaigikvpdnaniirnimlatlwchdhl
    vhfyqlagmdwidvldalkadprktselaqslsswpksspgyffdvqnrlkkfveggqlg
    ifrngywghpqyklppeanlmgfahylealdfqreivkihavfggknphpnwivggmpca
    inidesgavgavnmerlnlvqsiitrtadfinnvmipdalaigqfnkpwseigtglsdkc
    vlsygafpdiandfgeksllmpggavingdfnnvlpvdlvdpqqvqefvdhawyrypndq
    vgrhpfdgitdpwynpgdvkgsdtniqqlneqeryswikaprwrgnamevgplartliay
    hkgdaatvesvdrmmsalnlplsgiqstlgrilcraheaqwaagklqyffdklmtnlkng
    nlatastekwepatwptecrgvgfteaprgalghwaairdgkidlyqcvvpttwnasprd
    pkgqigayeaalmntkmaipeqpleilrtlhsfdpclacsth
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g7rM (M:)
    stqyetqgytinnagrrlvvdpitriqghmrcevnindqnvitnavscgtmfrgleiilq
    grdprdawafvericgvctgvhalasvyaiedaigikvpdnaniirnimlatlwchdhlv
    hfyqlagmdwidvldalkadprktselaqslsswpksspgyffdvqnrlkkfveggqlgi
    frngywghpqyklppeanlmgfahylealdfqreivkihavfggknphpnwivggmpcai
    nidesgavgavnmerlnlvqsiitrtadfinnvmipdalaigqfnkpwseigtglsdkcv
    lsygafpdiandfgeksllmpggavingdfnnvlpvdlvdpqqvqefvdhawyrypndqv
    grhpfdgitdpwynpgdvkgsdtniqqlneqeryswikaprwrgnamevgplartliayh
    kgdaatvesvdrmmsalnlplsgiqstlgrilcraheaqwaagklqyffdklmtnlkngn
    latastekwepatwptecrgvgfteaprgalghwaairdgkidlyqcvvpttwnasprdp
    kgqigayeaalmntkmaipeqpleilrtlhsfdpclacsth
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >6g7rS (S:)
    lenkpripvvwihglectcctesfirsahplakdvilslisldyddtlmaaagtqaeevf
    ediitqyngkyilavegnpplgeqgmfcissgrpfieklkraaagasaiiawgtcaswgc
    vqaarpnptqatpidkvitdkpiikvpgcppipdvmsaiitymvtfdrlpdvdrmgrplm
    fygqrihdkcyrrahfdagefvqswdddaarkgyclykmgckgpttynacsstrwndgvs
    fpiqsghgclgcaengfwdrgsfysrvvdipqmgthstadtvgltalgvvaaavgvhava
    savdqrrrhnqqptetehqpgnedkqarshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g7rS (S:)
    pripvvwihglectcctesfirsahplakdvilslisldyddtlmaaagtqaeevfedii
    tqyngkyilavegnpplgeqgmfcissgrpfieklkraaagasaiiawgtcaswgcvqaa
    rpnptqatpidkvitdkpiikvpgcppipdvmsaiitymvtfdrlpdvdrmgrplmfygq
    rihdkcyrrahfdagefvqswdddaarkgyclykmgckgpttynacsstrwndgvsfpiq
    sghgclgcaengfwdrgsfysrv
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >6g7rT (T:)
    lenkpripvvwihglectcctesfirsahplakdvilslisldyddtlmaaagtqaeevf
    ediitqyngkyilavegnpplgeqgmfcissgrpfieklkraaagasaiiawgtcaswgc
    vqaarpnptqatpidkvitdkpiikvpgcppipdvmsaiitymvtfdrlpdvdrmgrplm
    fygqrihdkcyrrahfdagefvqswdddaarkgyclykmgckgpttynacsstrwndgvs
    fpiqsghgclgcaengfwdrgsfysrvvdipqmgthstadtvgltalgvvaaavgvhava
    savdqrrrhnqqptetehqpgnedkqarshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g7rT (T:)
    pripvvwihglectcctesfirsahplakdvilslisldyddtlmaaagtqaeevfedii
    tqyngkyilavegnpplgeqgmfcissgrpfieklkraaagasaiiawgtcaswgcvqaa
    rpnptqatpidkvitdkpiikvpgcppipdvmsaiitymvtfdrlpdvdrmgrplmfygq
    rihdkcyrrahfdagefvqswdddaarkgyclykmgckgpttynacsstrwndgvsfpiq
    sghgclgcaengfwdrgsfysrv