PDB entry 6g7o

View 6g7o on RCSB PDB site
Description: crystal structure of human alkaline ceramidase 3 (acer3) at 2.7 angstrom resolution
Deposited on 2018-04-06, released 2019-01-02
The last revision was dated 2019-01-02, with a file datestamp of 2018-12-28.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alkaline ceramidase 3,Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NUN7 (1-243)
      • expression tag (0)
    • Uniprot P0ABE7 (244-348)
      • conflict (250)
      • conflict (345)
      • expression tag (349)
  • Heterogens: ZN, SO4, NA, OLB, CA, MG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6g7oA (A:)
fapaadregywgpttstldwceenysvtwyiaefwntvsnlimiippmfgavqsvrdgle
kryiasylaltvvgmgswcfhmtlkyemqlldelpmiysccifvycmfecfkiknsvnyh
llftlvlfslivttvylkvkepifhqvmygmlvftlvlrsiyivtwvypwlrglgytslg
ifllgflfwnidnifceslrnfrkkvppiigittqfhawwhiltglgsylhilfslytrt
lylradlednwetlndnlkviekadnaaqvkdaltkmraaaldaqkatppkledkspdsp
emkdfrhgfdilvgqiddalklanegkvkeaqaaaeqlkttrnayiqkyl