PDB entry 6g7m

View 6g7m on RCSB PDB site
Description: Four-site variant (Y222C, C197S, C432S, C433S) of E. coli hydrogenase-2
Class: oxidoreductase
Keywords: [NiFe]-Hydrogenase, hydrogen production, FeS clusters, nanoclusters, OXIDOREDUCTASE
Deposited on 2018-04-06, released 2019-04-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-03, with a file datestamp of 2019-03-29.
Experiment type: XRAY
Resolution: 1.71 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'L':
    Compound: Hydrogenase-2 large chain
    Species: Escherichia coli K12 [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ACE0
      • engineered mutation (196)
      • engineered mutation (431-432)
    Domains in SCOPe 2.07: d6g7ml_
  • Chain 'M':
    Compound: Hydrogenase-2 large chain
    Species: Escherichia coli K12 [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ACE0
      • engineered mutation (196)
      • engineered mutation (431-432)
    Domains in SCOPe 2.07: d6g7mm_
  • Chain 'S':
    Compound: Hydrogenase-2 small chain
    Species: Escherichia coli K12 [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69741
      • conflict (221)
    Domains in SCOPe 2.07: d6g7ms_
  • Chain 'T':
    Compound: Hydrogenase-2 small chain
    Species: Escherichia coli K12 [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69741
      • conflict (221)
    Domains in SCOPe 2.07: d6g7mt_
  • Heterogens: SF4, F3S, FCO, NI, MG, HOH

PDB Chain Sequences:

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6g7mL (L:)
    msqritidpvtrieghlridceiengvvskawasgtmwrgmeeivknrdprdawmivqri
    cgvcttthalssvraaesalnidvpvnaqyirniilaahtthdhivhfyqlsaldwvdit
    salqadptkasemlkgvstwhlnspeeftkvqnkikdlvasgqlgifangywghpamklp
    pevnliavahylqalesqrdanrvvallggktphiqnlavggvanpinldglgvlnlerl
    myiksfidklsdfveqvykvdtaviaafypewltrgkgavnylsvpefptdskngsflfp
    ggyienadlssyrpitshsdeylikgiqesakhswykdeapqapwegttipaydgwsddg
    kyswvksptfygktvevgplanmlvklaagrestqnklneivaiyqkltgntlevaqlhs
    tlgriigrtvhsselqdilqnqysalitnigkgdhttfvkpnipatgefkgvgfleaprg
    mlshwmvikdgiisnyqavvpstwnsgprnfnddvgpyeqslvgtpvadpnkplevvrti
    hsfdpcmacavhvvdadgnevvsvkvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g7mL (L:)
    sqritidpvtrieghlridceiengvvskawasgtmwrgmeeivknrdprdawmivqric
    gvcttthalssvraaesalnidvpvnaqyirniilaahtthdhivhfyqlsaldwvdits
    alqadptkasemlkgvstwhlnspeeftkvqnkikdlvasgqlgifangywghpamklpp
    evnliavahylqalesqrdanrvvallggktphiqnlavggvanpinldglgvlnlerlm
    yiksfidklsdfveqvykvdtaviaafypewltrgkgavnylsvpefptdskngsflfpg
    gyienadlssyrpitshsdeylikgiqesakhswykdeapqapwegttipaydgwsddgk
    yswvksptfygktvevgplanmlvklaagrestqnklneivaiyqkltgntlevaqlhst
    lgriigrtvhsselqdilqnqysalitnigkgdhttfvkpnipatgefkgvgfleaprgm
    lshwmvikdgiisnyqavvpstwnsgprnfnddvgpyeqslvgtpvadpnkplevvrtih
    sfdpcmacavh
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >6g7mM (M:)
    msqritidpvtrieghlridceiengvvskawasgtmwrgmeeivknrdprdawmivqri
    cgvcttthalssvraaesalnidvpvnaqyirniilaahtthdhivhfyqlsaldwvdit
    salqadptkasemlkgvstwhlnspeeftkvqnkikdlvasgqlgifangywghpamklp
    pevnliavahylqalesqrdanrvvallggktphiqnlavggvanpinldglgvlnlerl
    myiksfidklsdfveqvykvdtaviaafypewltrgkgavnylsvpefptdskngsflfp
    ggyienadlssyrpitshsdeylikgiqesakhswykdeapqapwegttipaydgwsddg
    kyswvksptfygktvevgplanmlvklaagrestqnklneivaiyqkltgntlevaqlhs
    tlgriigrtvhsselqdilqnqysalitnigkgdhttfvkpnipatgefkgvgfleaprg
    mlshwmvikdgiisnyqavvpstwnsgprnfnddvgpyeqslvgtpvadpnkplevvrti
    hsfdpcmacavhvvdadgnevvsvkvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g7mM (M:)
    sqritidpvtrieghlridceiengvvskawasgtmwrgmeeivknrdprdawmivqric
    gvcttthalssvraaesalnidvpvnaqyirniilaahtthdhivhfyqlsaldwvdits
    alqadptkasemlkgvstwhlnspeeftkvqnkikdlvasgqlgifangywghpamklpp
    evnliavahylqalesqrdanrvvallggktphiqnlavggvanpinldglgvlnlerlm
    yiksfidklsdfveqvykvdtaviaafypewltrgkgavnylsvpefptdskngsflfpg
    gyienadlssyrpitshsdeylikgiqesakhswykdeapqapwegttipaydgwsddgk
    yswvksptfygktvevgplanmlvklaagrestqnklneivaiyqkltgntlevaqlhst
    lgriigrtvhsselqdilqnqysalitnigkgdhttfvkpnipatgefkgvgfleaprgm
    lshwmvikdgiisnyqavvpstwnsgprnfnddvgpyeqslvgtpvadpnkplevvrtih
    sfdpcmacavh
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >6g7mS (S:)
    emaesvtnpqrppviwigaqectgctesllrathptvenlvletisleyhevlsaafghq
    veenkhnalekykgqyvlvvdgsiplkdngiycmvagepivdhirkaaegaaaiiaigsc
    sawggvaaagvnptgavslqevlpgktvinipgcppnphnflatvahiitygkppklddk
    nrptfaygrlihehcerrphfdagrfakefgdeghregwclchlgckgpetygncstlqf
    cdvggvwpvaighpcygcneegigfhkgihqlanvenqtprsqkpdvnakeggnvsrshh
    hhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g7mS (S:)
    pqrppviwigaqectgctesllrathptvenlvletisleyhevlsaafghqveenkhna
    lekykgqyvlvvdgsiplkdngiycmvagepivdhirkaaegaaaiiaigscsawggvaa
    agvnptgavslqevlpgktvinipgcppnphnflatvahiitygkppklddknrptfayg
    rlihehcerrphfdagrfakefgdeghregwclchlgckgpetygncstlqfcdvggvwp
    vaighpcygcneegigfhkgihqlanve
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >6g7mT (T:)
    emaesvtnpqrppviwigaqectgctesllrathptvenlvletisleyhevlsaafghq
    veenkhnalekykgqyvlvvdgsiplkdngiycmvagepivdhirkaaegaaaiiaigsc
    sawggvaaagvnptgavslqevlpgktvinipgcppnphnflatvahiitygkppklddk
    nrptfaygrlihehcerrphfdagrfakefgdeghregwclchlgckgpetygncstlqf
    cdvggvwpvaighpcygcneegigfhkgihqlanvenqtprsqkpdvnakeggnvsrshh
    hhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g7mT (T:)
    pqrppviwigaqectgctesllrathptvenlvletisleyhevlsaafghqveenkhna
    lekykgqyvlvvdgsiplkdngiycmvagepivdhirkaaegaaaiiaigscsawggvaa
    agvnptgavslqevlpgktvinipgcppnphnflatvahiitygkppklddknrptfayg
    rlihehcerrphfdagrfakefgdeghregwclchlgckgpetygncstlqfcdvggvwp
    vaighpcygcneegigfhkgihqlanve