PDB entry 6g7l

View 6g7l on RCSB PDB site
Description: Retinal isomerization in bacteriorhodopsin revealed by a femtosecond X-ray laser: 8.3 ms state structure
Class: proton transport
Keywords: retinal isomerization, ultrafast, femtosecond, room temperature, time resolved crystallography, PROTON TRANSPORT
Deposited on 2018-04-06, released 2018-06-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-27, with a file datestamp of 2018-06-22.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bacteriorhodopsin
    Species: Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) [TaxId:64091]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6g7la_
  • Heterogens: RET, LI1, OLC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6g7lA (A:)
    mlellptavegvsqaqitgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaitt
    lvpaiaftmylsmllgygltmvpfggeqnpiywaryadwlfttplllldlallvdadqgt
    ilalvgadgimigtglvgaltkvysyrfvwwaistaamlyilyvlffgftskaesmrpev
    astfkvlrnvtvvlwsaypvvwligsegagivplnietllfmvldvsakvgfglillrsr
    aifgeaeapepsagdgaaatsd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g7lA (A:)
    tgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsmllgy
    gltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigtglv
    galtkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvlwsa
    ypvvwligsegagivplnietllfmvldvsakvgfglillrsraifgeae