PDB entry 6g7g

View 6g7g on RCSB PDB site
Description: structure of sph (self-incompatibility protein homologue) proteins, a widespread family of small, highly stable, secreted proteins from plants
Deposited on 2018-04-06, released 2019-03-06
The last revision was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: S-protein homolog 15
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: SPH15, At5g39493, MUL8.19
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9FLY6 (3-114)
      • expression tag (0-2)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6g7gA (A:)
amgckeieivikntlgpsrilqyhcrsgntnvgvqylnfkgtriikfkddgtersrwncl
frqginmkffteveayrpdlkhplcgkryelsarmdaiyfkmderppqplnkwrs