PDB entry 6g77

View 6g77 on RCSB PDB site
Description: RSK4 N-terminal Kinase Domain in complex with AMP-PNP
Class: transferase
Keywords: RSK4, AGC kinase, p90 ribosomal S6 kinases, transferase
Deposited on 2018-04-04, released 2019-04-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-07-28, with a file datestamp of 2021-07-23.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribosomal protein S6 kinase alpha-6
    Species: Homo sapiens [TaxId:9606]
    Gene: RPS6KA6, RSK4
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UK32 (5-306)
      • expression tag (0-4)
    Domains in SCOPe 2.08: d6g77a_
  • Chain 'B':
    Compound: Ribosomal protein S6 kinase alpha-6
    Species: Homo sapiens [TaxId:9606]
    Gene: RPS6KA6, RSK4
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UK32 (5-306)
      • expression tag (0-4)
    Domains in SCOPe 2.08: d6g77b_
  • Heterogens: ANP, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6g77A (A:)
    gplgsdegvvkeipithhvkegyekadpaqfellkvlgqgsfgkvflvrkktgpdagqly
    amkvlkkaslkvrdrvrtkmerdilvevnhpfivklhyafqtegklylildflrggdvft
    rlskevlfteedvkfylaelalaldhlhqlgivyrdlkpenilldeighikltdfglske
    svdqekkaysfcgtveymapevvnrrghsqsadwwsygvlmfemltgtlpfqgkdrnetm
    nmilkaklgmpqflsaeaqsllrmlfkrnpanrlgsegveeikrhlffanidwdklykre
    vqppfkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g77A (A:)
    vvkeipithhvkegyekadpaqfellkvlgqgsfgkvflvrkktgpdagqlyamkvlkka
    slkvrddilvevnhpfivklhyafqtegklylildflrggdvftrlskevlfteedvkfy
    laelalaldhlhqlgivyrdlkpenilldeighikltdfglskesvdqekkaysfcgtve
    ymapevvnrrghsqsadwwsygvlmfemltgtlpfqgkdrnetmnmilkaklgmpqflsa
    eaqsllrmlfkrnpanrlgsegveeikrhlffanidwdklykrevqppfkp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6g77B (B:)
    gplgsdegvvkeipithhvkegyekadpaqfellkvlgqgsfgkvflvrkktgpdagqly
    amkvlkkaslkvrdrvrtkmerdilvevnhpfivklhyafqtegklylildflrggdvft
    rlskevlfteedvkfylaelalaldhlhqlgivyrdlkpenilldeighikltdfglske
    svdqekkaysfcgtveymapevvnrrghsqsadwwsygvlmfemltgtlpfqgkdrnetm
    nmilkaklgmpqflsaeaqsllrmlfkrnpanrlgsegveeikrhlffanidwdklykre
    vqppfkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g77B (B:)
    vvkeipithhvkegyekadpaqfellkvlgqgsfgkvflvrkktgpdagqlyamkvlkka
    slkvrddilvevnhpfivklhyafqtegklylildflrggdvftrlskevlfteedvkfy
    laelalaldhlhqlgivyrdlkpenilldeighikltdfglskesvdqekkaysfcgtve
    ymapevvnrrghsqsadwwsygvlmfemltgtlpfqgkdrnetmnmilkaklgmpqflsa
    eaqsllrmlfkrnpanrlgsegveeikrhlffanidwdklykrevqppfkp