PDB entry 6g76

View 6g76 on RCSB PDB site
Description: Phosphorylated RSK4 N-terminal Kinase Domain in complex with AMP-PNP
Class: transferase
Keywords: RSK4, AGC kinase, p90 ribosomal S6 kinases, transferase
Deposited on 2018-04-04, released 2019-04-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-17, with a file datestamp of 2019-04-12.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribosomal protein S6 kinase alpha-6
    Species: Homo sapiens [TaxId:9606]
    Gene: RPS6KA6, RSK4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6g76a_
  • Chain 'B':
    Compound: Ribosomal protein S6 kinase alpha-6
    Species: Homo sapiens [TaxId:9606]
    Gene: RPS6KA6, RSK4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6g76b_
  • Heterogens: ANP, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6g76A (A:)
    gplgsdegvvkeipithhvkegyekadpaqfellkvlgqgsfgkvflvrkktgpdagqly
    amkvlkkaslkvrdrvrtkmerdilvevnhpfivklhyafqtegklylildflrggdvft
    rlskevlfteedvkfylaelalaldhlhqlgivyrdlkpenilldeighikltdfglske
    svdqekkaysfcgtveymapevvnrrghsqsadwwsygvlmfemltgtlpfqgkdrnetm
    nmilkaklgmpqflsaeaqsllrmlfkrnpanrlgsegveeikrhlffanidwdklykre
    vqppfkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g76A (A:)
    vvkeipithhvkegyekadpaqfellkvlgqgsfgkvflvrkktgpdagqlyamkvlkka
    slkvrddilvevnhpfivklhyafqtegklylildflrggdvftrlskevlfteedvkfy
    laelalaldhlhqlgivyrdlkpenilldeighikltdfglskesvdqekkaysfcgtve
    ymapevvnrrghsqsadwwsygvlmfemltgtlpfqgkdrnetmnmilkaklgmpqflsa
    eaqsllrmlfkrnpanrlgsegveeikrhlffanidwdklykrevqppfkp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6g76B (B:)
    gplgsdegvvkeipithhvkegyekadpaqfellkvlgqgsfgkvflvrkktgpdagqly
    amkvlkkaslkvrdrvrtkmerdilvevnhpfivklhyafqtegklylildflrggdvft
    rlskevlfteedvkfylaelalaldhlhqlgivyrdlkpenilldeighikltdfglske
    svdqekkaysfcgtveymapevvnrrghsqsadwwsygvlmfemltgtlpfqgkdrnetm
    nmilkaklgmpqflsaeaqsllrmlfkrnpanrlgsegveeikrhlffanidwdklykre
    vqppfkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g76B (B:)
    vvkeipithhvkegyekadpaqfellkvlgqgsfgkvflvrkktgpdagqlyamkvlkka
    slkvrdilvevnhpfivklhyafqtklylildflrggdvftrlskevlfteedvkfylae
    lalaldhlhqlgivyrdlkpenilldeighikltdfglskesvdveymapevvnrrghsq
    sadwwsygvlmfemltgtlpfqgkdrnetlgmpqflsaeaqsllrmlfkrnpanrlgseg
    veeikrhlffanidwdklykrevqppfkp