PDB entry 6g6w

View 6g6w on RCSB PDB site
Description: human pi3kdelta in complex with ligand lasw1976
Class: transferase
Keywords: pi3kdelta kinase, proteros biostructures gmbh, transferase
Deposited on 2018-04-03, released 2018-11-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-11-21, with a file datestamp of 2018-11-16.
Experiment type: XRAY
Resolution: 2.72 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform
    Species: Homo sapiens [TaxId:9606]
    Gene: Pik3cd
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Phosphatidylinositol 3-kinase regulatory subunit alpha
    Species: Bos taurus [TaxId:9913]
    Gene: PIK3R1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6g6wb_
  • Heterogens: EO5, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >6g6wB (B:)
myqqdqvvkednieavgkklheyntqfqeksreydrlyedytrtsqeiqmkrtaieafne
tikifeeqcqtqeryskeyiekfkregneteiqrimhnyeklksriseivdsrrrleedl
kkqaaeyreidkrmnsikpdliqlrktrdqylmwltqkgvrqkklnewlg

    Sequence, based on observed residues (ATOM records): (download) 
    >6g6wB (B:)
dnieavgkklheyntqfqeksreydrlyedytrtsqeiqmkrtaieafnetikifeeqcq
tqeryskeyiekteiqrimhnyeklksriseivdsrrrleedlkkqaaeyreidkrmnsi
kpdliqlrktrdqylmwltqkgvrqkklnewlg